Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9list-w7di45

Listeria rocourtiae FSL F6-920. Two component regulator three Y domain-containing protein

Relationship
Family|Asp2
Block| X
Position in NCBI Life Tree|Listeria rocourtiae FSL F6-920
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Listeriaceae: N E > Listeria: N E > Listeria rocourtiae: N E > Listeria rocourtiae FSL F6-920: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9list-w7di45
Colored MSA for Asp2 (raw)
MTSDIIIEKLDTSRLAYTAGKLVVNFKALYMLEATYTYAYYIYYNDQIVE
RQWYQPIDKQQVTVTYQPIRSGAYKIRLFLKKDDTLIINKMTNMLNVDVA
NQQTVTTTLEKEEIYYNDHPVKYLFQPAKTPSDKLVISFSGLHSNEFRGG
PPVYNHFRTLWPCDVNKLFILDEYKGQFCYYMGHNRRSDYERSVIALIMT
KANELGISSRNIIASGSSKGGAASLYYSMKYHFGTAIVGAPQVFLAKFLK
QRATNAPVVRKGLNNMLGEDKAAGEKYYDELIMNLVDTNTTFPDFIFHIG
KGDYHYPQHLQPLLKKLDQKGVPYQLDLQDYSDHNQTGQYYAPFLFETIS
KMIQK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSDIIIEKLDTSRLAYTAGKLVVNFKALYMLEATYTYAYYIYYNDQIVE
RQWYQPIDKQQVTVTYQPIRSGAYKIRLFLKKDDTLIINKMTNMLNVDVA
NQQTVTTTLEKEEIYYNDHPVKYLFQPAKTPSDKLVISFSGLHSNEFRGG
PPVYNHFRTLWPCDVNKLFILDEYKGQFCYYMGHNRRSDYERSVIALIMT
KANELGISSRNIIASGSSKGGAASLYYSMKYHFGTAIVGAPQVFLAKFLK
QRATNAPVVRKGLNNMLGEDKAAGEKYYDELIMNLVDTNTTFPDFIFHIG
KGDYHYPQHLQPLLKKLDQKGVPYQLDLQDYSDHNQTGQYYAPFLFETIS
KMIQK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer