Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9micc-q4nkx7

Arthrobacter sp. FB24 phospholipase/carboxylesterase

Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Arthrobacter sp. FB24
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Micrococcaceae: N E > Arthrobacter: N E > Arthrobacter sp. FB24: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AAHG01000001, WP_011690176, ABK01706
1 UniProt : A0JRN6
1 Interpro : A0JRN6
1 Pfam : A0JRN6
1 PIRSF : A0JRN6
1 SUPERFAM : A0JRN6
Sequence
Graphical view for this peptide sequence: 9micc-q4nkx7
Colored MSA for LYsophospholipase_carboxylesterase (raw)
METVVWSRPENQRAGTPLLVMMHGYGTDEVRMSDLFGQLPPEFTCAALRA
PKVIGDDYGWFLLDYFLTHDFADVISVSNKVFDWINSVKAQHSSVSLLGF
SQGMAMASTLLRLRPQDFRAVVGLSGFVLDNELLAMSESFDAKPPFFWGR
DKADLVINDAAVEHTAEWLHRNTQLTARTYPGMGHTISKAEMVDVSAFLR
HYVLR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

METVVWSRPENQRAGTPLLVMMHGYGTDEVRMSDLFGQLPPEFTCAALRA
PKVIGDDYGWFLLDYFLTHDFADVISVSNKVFDWINSVKAQHSSVSLLGF
SQGMAMASTLLRLRPQDFRAVVGLSGFVLDNELLAMSESFDAKPPFFWGR
DKADLVINDAAVEHTAEWLHRNTQLTARTYPGMGHTISKAEMVDVSAFLR
HYVLR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer