Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9myco-a0a0j6vre4

Mycobacterium chubuense. Carboxylesterase NlhH

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Mycobacterium chubuense
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium chubuense: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : JYNX01000062
1 UniProt : A0A0J6VRE4
1 UniProt : A0A0J6VRE4
1 Interpro : A0A0J6VRE4
1 Prodom : A0A0J6VRE4
1 Pfam : A0A0J6VRE4
1 PIRSF : A0A0J6VRE4
1 SUPERFAM : A0A0J6VRE4
Sequence
Graphical view for this peptide sequence: 9myco-a0a0j6vre4
Colored MSA for Hormone-sensitive_lipase_like (raw)
MLHGRRADPDATLATDPRSDPRMVAALAAFGLTERLPSSGLGVDSPLAER
LAYATMSEQGIGAIFDALAQDIAPPAGVTTITTTITGADGNDVTLFISRP
TDASGPLPAIVHLHGGGMAIASAADMPYVRLREHLAATGLVVIGVEFRNS
GGKLGPHPYPAGLNDCASAARWVDEQRGELGVGHIVVSGESGGGNLTLTL
AHKAKREGWIDRIAGFYAQCPFISNRWLDAGDELPSLVENDEYFISREQL
AILGSLYDPDGRHVDDAACWAYVATDDELAGLPPHVISVNELDPLRDEGL
QYYRRLLRAGVPTVGRVVAGTCHGGDLLLASAMPEVFAASVRDVSGFAHS
LRSG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLHGRRADPDATLATDPRSDPRMVAALAAFGLTERLPSSGLGVDSPLAER
LAYATMSEQGIGAIFDALAQDIAPPAGVTTITTTITGADGNDVTLFISRP
TDASGPLPAIVHLHGGGMAIASAADMPYVRLREHLAATGLVVIGVEFRNS
GGKLGPHPYPAGLNDCASAARWVDEQRGELGVGHIVVSGESGGGNLTLTL
AHKAKREGWIDRIAGFYAQCPFISNRWLDAGDELPSLVENDEYFISREQL
AILGSLYDPDGRHVDDAACWAYVATDDELAGLPPHVISVNELDPLRDEGL
QYYRRLLRAGVPTVGRVVAGTCHGGDLLLASAMPEVFAASVRDVSGFAHS
LRSG


Reference
    Title: Characterization of Three Mycobacterium spp. with Potential Use in Bioremediation by Genome Sequencing and Comparative Genomics
    Das S, Pettersson BM, Behra PR, Ramesh M, Dasgupta S, Bhattacharya A, Kirsebom LA
    Ref: Genome Biol Evol, 7:1871, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer