Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9myco-a0a1a3jde0

Mycobacterium sp.; Mycobacterium chimaera; Mycobacterium yongonense; Mycobacterium intracellulare Uncharacterized protein

Comment
Other strains: Mycobacterium chimaera; Mycobacterium sp.; Mycobacterium yongonense; Mycobacterium intracellulare


Relationship
Family|Abhydrolase_9
Block| X
Position in NCBI Life Tree|Mycobacterium sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium: N E > Mycobacterium sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : WP_054585964, WP_067171529, WP_065498540
1 UniProt : X8CQU4
1 Interpro : X8CQU4
1 Prodom : X8CQU4
1 Pfam : X8CQU4
1 PIRSF : X8CQU4
1 SUPERFAM : X8CQU4
Sequence
Graphical view for this peptide sequence: 9myco-a0a1a3jde0
Colored MSA for Abhydrolase_9 (raw)
MSEPGSATNIDTGDKPADDVEESASAGPEAAPEPAPAPRAGRAAPTLPWT
EKPWWVRHYTFTGTTVGLIFIWLSLTPSLLPRGPLFQGLVSGLSGAIGYG
LGVFSVWLVRFMREKDHSPPPPRWAWKVLIPIGVVGQVLMAIWFHVWQDD
VRDLMGVAHLKWYDYPLSGVLSLVVLFTVVEIGQFTRWLVRFLVNQVDRF
VPFRLSATIVVVTLAVLTVTVLNGVVLKFAMRTMNDTFASANNEMNPDSA
PPKTALRSGGPESLVSWESLGHQGRVFVEGGPKVDDLTAFNGAPAAEPIR
AYAGLNSADGITATAELAARELQRTGGLRRAVVAVATTTGTGWINEAEAT
ALEYMYNGNTAIVSMQYSFLPSWLSFLVDKENARHAGQALFEAVDRLIRQ
MPEGQRPKLVVFGESLGSFGGEASFMSLNNVLARTDGALFSGPTFQNTIW
TDLTTTRDAGSPEWLPIYDDGRYVRFVARSGNLARPKDPWDHPRVVYLQH
ASDPIAWWTPDLVFSKPDWLRERRGYDVLPQTRWIPVVTFLQVSADMAVA
VDVPDGHGHRYVADVADGWAAVMSPPGWTPEKTAKLRPLLHAGD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSEPGSATNIDTGDKPADDVEESASAGPEAAPEPAPAPRAGRAAPTLPWT
EKPWWVRHYTFTGTTVGLIFIWLSLTPSLLPRGPLFQGLVSGLSGAIGYG
LGVFSVWLVRFMREKDHSPPPPRWAWKVLIPIGVVGQVLMAIWFHVWQDD
VRDLMGVAHLKWYDYPLSGVLSLVVLFTVVEIGQFTRWLVRFLVNQVDRF
VPFRLSATIVVVTLAVLTVTVLNGVVLKFAMRTMNDTFASANNEMNPDSA
PPKTALRSGGPESLVSWESLGHQGRVFVEGGPKVDDLTAFNGAPAAEPIR
AYAGLNSADGITATAELAARELQRTGGLRRAVVAVATTTGTGWINEAEAT
ALEYMYNGNTAIVSMQYSFLPSWLSFLVDKENARHAGQALFEAVDRLIRQ
MPEGQRPKLVVFGESLGSFGGEASFMSLNNVLARTDGALFSGPTFQNTIW
TDLTTTRDAGSPEWLPIYDDGRYVRFVARSGNLARPKDPWDHPRVVYLQH
ASDPIAWWTPDLVFSKPDWLRERRGYDVLPQTRWIPVVTFLQVSADMAVA
VDVPDGHGHRYVADVADGWAAVMSPPGWTPEKTAKLRPLLHAGD



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer