Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pezi-a0a167btm8

Colletotrichum incanum. Paf acetylhydrolase

Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Colletotrichum incanum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Glomerellales: N E > Glomerellaceae: N E > Colletotrichum: N E > Colletotrichum incanum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : LFIW01001599, KV842108
1 UniProt : A0A167BTM8
1 UniProt : A0A167BTM8
1 Interpro : A0A167BTM8
1 Pfam : A0A167BTM8
1 PIRSF : A0A167BTM8
1 SUPERFAM : A0A167BTM8
Sequence
Graphical view for this peptide sequence: 9pezi-a0a167btm8
Colored MSA for PAF-Acetylhydrolase (raw)
MISALILWGLASATQAVLVSPPTGPYAVSMSVQGLTDNARLDPYAPKNRP
HSRQVMISTFMPVDEVKTPCSGWKIVPYMTPLVAKAYDELGTAVGFPNGT
FSALKIEFCQIRTRSCQRSRSEFPLVLFSPGWGNPRLLYSGLAREVASHG
FTVITIDHPYDPSFVEFPDGTVYQAISLDTDNTTELETLTQVRAEDTSFV
LSHFHKNPIPGVDLNRTIMFGHSLGGATAAAAMLTDSRIRGGINFDGKLL
NPVLEAGLDGPFVLVGRPEHVQEDPAWNEFYASLRGPSALLSVSGTTHAS
FTDFPTLILSLNLALPEAAKTLLEAELGTLKYGRIGHVVSGIVKAFADLS
LNQQVGQLFTRGGDAAFPEVYVQKSNI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MISALILWGLASATQAVLVSPPTGPYAVSMSVQGLTDNARLDPYAPKNRP
HSRQVMISTFMPVDEVKTPCSGWKIVPYMTPLVAKAYDELGTAVGFPNGT
FSALKIEFCQIRTRSCQRSRSEFPLVLFSPGWGNPRLLYSGLAREVASHG
FTVITIDHPYDPSFVEFPDGTVYQAISLDTDNTTELETLTQVRAEDTSFV
LSHFHKNPIPGVDLNRTIMFGHSLGGATAAAAMLTDSRIRGGINFDGKLL
NPVLEAGLDGPFVLVGRPEHVQEDPAWNEFYASLRGPSALLSVSGTTHAS
FTDFPTLILSLNLALPEAAKTLLEAELGTLKYGRIGHVVSGIVKAFADLS
LNQQVGQLFTRGGDAAFPEVYVQKSNI


Reference
    Title: Genus-Wide Comparative Genome Analyses of Colletotrichum Species Reveal Specific Gene Family Losses and Gains during Adaptation to Specific Infection Lifestyles
    Gan P, Narusaka M, Kumakura N, Tsushima A, Takano Y, Narusaka Y, Shirasu K
    Ref: Genome Biol Evol, 8:1467, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer