Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pezi-s4vch4

Sirococcus conigenus Cutinase 1 ScCut

Comment
Best pNP substrate pNP-C4 Paranitrophenylbutyrate


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Sirococcus conigenus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Sordariomycetidae: N E > Diaporthales: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





2 substrates: Paranitrophenyl-palmitate, Paranitrophenylbutyrate
No inhibitor
1 Genbank : AGO59082
1 UniProt : S4VCH4
1 UniProt : S4VCH4
1 Interpro : S4VCH4
1 Prodom : S4VCH4
1 Pfam : S4VCH4
1 PIRSF : S4VCH4
1 SUPERFAM : S4VCH4
Sequence
Graphical view for this peptide sequence: 9pezi-s4vch4
Colored MSA for Cutinase (raw)
MKSTILFSALLSSGALAAPTVVEAVEARAACSDMTIIFARGTTEPGTVGT
LAGPPFFAAVKSQLGGRATLTTQGVDYPANIAGFLAGGDPAGSQTMANDV
KAALAACPDTKLVMAGYSQGGQLVHNAAKLLGGTMSQVNSAVIFGDPDNG
QPVAGLSAAQTKIICHAGDNICQGGALILAPHLTYGQDAGTAASFVIAAA
GL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKSTILFSALLSSGALAAPTVVEAVEARAACSDMTIIFARGTTEPGTVGT
LAGPPFFAAVKSQLGGRATLTTQGVDYPANIAGFLAGGDPAGSQTMANDV
KAALAACPDTKLVMAGYSQGGQLVHNAAKLLGGTMSQVNSAVIFGDPDNG
QPVAGLSAAQTKIICHAGDNICQGGALILAPHLTYGQDAGTAASFVIAAA
GL


References
    Title: Phylogenetic analysis and in-depth characterization of functionally and structurally diverse CE5 cutinases
    Novy V, Carneiro LV, Shin JH, Larsbrink J, Olsson L
    Ref: Journal of Biological Chemistry, :101302, 2021 : PubMed

            

    Title: Cloning and characterization of a novel acidic cutinase from Sirococcus conigenus
    Nyyssola A, Pihlajaniemi V, Hakkinen M, Kontkanen H, Saloheimo M, Nakari-Setala T
    Ref: Applied Microbiology & Biotechnology, 98:3639, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer