Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9pseu-m2yta0

Amycolatopsis decaplanina DSM 44594. Tripeptidyl aminopeptidase

Relationship
Family|Peptidase_S37
Block| X
Position in NCBI Life Tree|Amycolatopsis decaplanina DSM 44594
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Pseudonocardiales: N E > Pseudonocardiaceae: N E > Amycolatopsis: N E > Amycolatopsis decaplanina: N E > Amycolatopsis decaplanina DSM 44594: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AOHO01000014, WP_007028115
1 UniProt : M2YTA0
1 UniProt : M2YTA0
1 Interpro : M2YTA0
1 Prodom : M2YTA0
1 Pfam : M2YTA0
1 PIRSF : M2YTA0
1 SUPERFAM : M2YTA0
Sequence
Graphical view for this peptide sequence: 9pseu-m2yta0
Colored MSA for Peptidase_S37 (raw)
MRKLTAAWSVLAIIVLALAGLTPAAQAAPEDIKDALGRIPGLTVVSENPA
PTGYRFFKLTYTQPVDHRRPGAGTFQQRFTLLHKEFRSPTVVYTSGYNVS
ESPNRSEPTQLVDGNQLSMEYRFFTPSRPERPDWGKQLTIWQAAADQHRA
VEAFKRLYPGKWLATGGSKGGMTATYFRRFFPDDVDATIPYVAPNDVINE
HDRYNEFLANVGNDPACRSALKAIQRDVLTRRSEFAALAAAEAAKNGYTF
NTVGSADVSLEISVIDSYFAFWQYQKQADCATIPKAGAPAAEVYAWFERV
ESLNTYSDQNLEIYVPYYFQASYQLGAPESYEGYLRDLLRYPGSNVSRTF
VPKSVDIPRFDHLAMPDIDFWVKSRGKRLMFIYGGNDPWGAEPFRLGFGT
KDSYSYTVPGGNHGARISQLPAAQAAEATNTVRRWAGLPPVSPGVSTRSV
PAGFPDFDADLTMLHRPRL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRKLTAAWSVLAIIVLALAGLTPAAQAAPEDIKDALGRIPGLTVVSENPA
PTGYRFFKLTYTQPVDHRRPGAGTFQQRFTLLHKEFRSPTVVYTSGYNVS
ESPNRSEPTQLVDGNQLSMEYRFFTPSRPERPDWGKQLTIWQAAADQHRA
VEAFKRLYPGKWLATGGSKGGMTATYFRRFFPDDVDATIPYVAPNDVINE
HDRYNEFLANVGNDPACRSALKAIQRDVLTRRSEFAALAAAEAAKNGYTF
NTVGSADVSLEISVIDSYFAFWQYQKQADCATIPKAGAPAAEVYAWFERV
ESLNTYSDQNLEIYVPYYFQASYQLGAPESYEGYLRDLLRYPGSNVSRTF
VPKSVDIPRFDHLAMPDIDFWVKSRGKRLMFIYGGNDPWGAEPFRLGFGT
KDSYSYTVPGGNHGARISQLPAAQAAEATNTVRRWAGLPPVSPGVSTRSV
PAGFPDFDADLTMLHRPRL


Reference
    Title: Draft Genome Sequence of Amycolatopsis decaplanina Strain DSM 44594T
    Kaur N, Kumar S, Bala M, Raghava GP, Mayilraj S
    Ref: Genome Announc, 1:e0013813, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer