Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9rhoo-b4y2w1

Thauera sp. E7 Putative epoxide hydrolase

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Thauera sp. E7
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Rhodocyclales: N E > Zoogloeaceae: N E > Thauera: N E > Thauera sp. E7: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EU327987
1 UniProt : B4Y2W1
1 UniProt : B4Y2W1
1 Interpro : B4Y2W1
1 Prodom : B4Y2W1
1 Pfam : B4Y2W1
1 PIRSF : B4Y2W1
1 SUPERFAM : B4Y2W1
Sequence
Graphical view for this peptide sequence: 9rhoo-b4y2w1
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MTSSSDLPIPLDQFAELDSGLRLHYLDVGQGPVVVWLHGSGPGASGYSNF
KGNYPAFAEAGFRNIVLDLPGFGRSDKPADVQYNLAFFVTCLNAFLGKIG
VEKCTLLGNSLGGAIALGQALAHPDTVERLILMAPGGVEERETYFKMEGI
VRMVETFAKGPMGPVEMRHVMSLQVFDPSLLDDSIINERAAIAPSQPANL
FSTMMVPNMTTRLHEIKAPIFGFWGTDDKFNPHTGALKVIENAPNARMIL
LNQCGHWVQVEHRELFNRSCIDFLTKG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTSSSDLPIPLDQFAELDSGLRLHYLDVGQGPVVVWLHGSGPGASGYSNF
KGNYPAFAEAGFRNIVLDLPGFGRSDKPADVQYNLAFFVTCLNAFLGKIG
VEKCTLLGNSLGGAIALGQALAHPDTVERLILMAPGGVEERETYFKMEGI
VRMVETFAKGPMGPVEMRHVMSLQVFDPSLLDDSIINERAAIAPSQPANL
FSTMMVPNMTTRLHEIKAPIFGFWGTDDKFNPHTGALKVIENAPNARMIL
LNQCGHWVQVEHRELFNRSCIDFLTKG


Reference
    Title: The evolution of class 1 integrons and the rise of antibiotic resistance
    Gillings M, Boucher Y, Labbate M, Holmes A, Krishnan S, Holley M, Stokes HW
    Ref: Journal of Bacteriology, 190:5095, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer