Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9sphn-q2n6l4

Erythrobacter litoralis HTCC2594 prolyl oligopeptidase family protein

Comment
old Q4TRU5 Q4TRU5_9SPHN ELI0431


Relationship
Family|Prolyl_oligopeptidase_S9
Block| X
Position in NCBI Life Tree|Erythrobacter litoralis HTCC2594
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Sphingomonadales: N E > Erythrobacteraceae: N E > Erythrobacter: N E > Erythrobacter litoralis: N E > Erythrobacter litoralis HTCC2594: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AAGG01000001, CP000157
1 UniProt : Q2N6L4
1 UniProt : Q2N6L4
1 Interpro : Q2N6L4
1 Pfam : Q2N6L4
1 PIRSF : Q2N6L4
1 SUPERFAM : Q2N6L4
Sequence
Graphical view for this peptide sequence: 9sphn-q2n6l4
Colored MSA for Prolyl_oligopeptidase_S9 (raw)
METAEPMTARDLVTMPRLGAPTVTGDGRYAVFAITVTDDETLKRTSELHL
RDLTDLDAATTKLDLLGSARSAAFGPDNWLYFLSDREGAGTGSKAGSVQV
WRASLEADGSVKGPLPVTDFGTDVDGFSLSPAGDAIAVWAEIARDCPRFG
CDGDGTAHLPSPGNGRLYDGADGFYRHWDTWETPGTFSRVFVFGLENGKT
VGDGKALDGPPGDGASITGDTPTKPFGGGEDIAWAADGSAIYFVARKADG
DEPTSTNLDIYRSDLDGGAPENLTAGNLATDTSPVPSPDGRYLAYLAMAR
PGYESDKLTVMLRDLASGESRALTPDYDRSFHSLAWTPDSRWLVATAQDV
LDTPAFRIDPQTGAVEKLDLMAGNEAHIANVMPLPGERLLFARDSIGSPS
HLFLSDGWQQAKPLVLVGGPEVGAMASVQTTRFSFAGAGGDTVWGQITKL
EGADGPMPAILYIHGGPQGSFNDGWSSRWNPRVLASQGYAVISVDFHGST
GYGQAFTDSINRDWGGKPLEDLQKGLAAALARDPQIDGNRACAMGASYGG
YMVNWIAGNWPDRFKCLVQHDGLFDMRSFYYTTEELWFPRWDFGGSYAEA
VETYERWNPVNYVNNWQTPMLVVAGERDFRVPYTQGLASFTALQERDIPS
QLLVFPDENHWVLGGKNSLQWHETVFAWLDRWLKEDGEAGE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

METAEPMTARDLVTMPRLGAPTVTGDGRYAVFAITVTDDETLKRTSELHL
RDLTDLDAATTKLDLLGSARSAAFGPDNWLYFLSDREGAGTGSKAGSVQV
WRASLEADGSVKGPLPVTDFGTDVDGFSLSPAGDAIAVWAEIARDCPRFG
CDGDGTAHLPSPGNGRLYDGADGFYRHWDTWETPGTFSRVFVFGLENGKT
VGDGKALDGPPGDGASITGDTPTKPFGGGEDIAWAADGSAIYFVARKADG
DEPTSTNLDIYRSDLDGGAPENLTAGNLATDTSPVPSPDGRYLAYLAMAR
PGYESDKLTVMLRDLASGESRALTPDYDRSFHSLAWTPDSRWLVATAQDV
LDTPAFRIDPQTGAVEKLDLMAGNEAHIANVMPLPGERLLFARDSIGSPS
HLFLSDGWQQAKPLVLVGGPEVGAMASVQTTRFSFAGAGGDTVWGQITKL
EGADGPMPAILYIHGGPQGSFNDGWSSRWNPRVLASQGYAVISVDFHGST
GYGQAFTDSINRDWGGKPLEDLQKGLAAALARDPQIDGNRACAMGASYGG
YMVNWIAGNWPDRFKCLVQHDGLFDMRSFYYTTEELWFPRWDFGGSYAEA
VETYERWNPVNYVNNWQTPMLVVAGERDFRVPYTQGLASFTALQERDIPS
QLLVFPDENHWVLGGKNSLQWHETVFAWLDRWLKEDGEAGE



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer