Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9stra-f0wq48

Albugo laibachii Nc14 Lysosomal ProX carboxypeptidase putative

Comment
Pfam A Peptidase_S28 88 527


Relationship
Family|Prolylcarboxypeptidase
Block| X
Position in NCBI Life Tree|Albugo laibachii Nc14
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Stramenopiles: N E > Oomycetes: N E > Albuginales: N E > Albuginaceae: N E > Albugo: N E > Albugo laibachii: N E > Albugo laibachii Nc14: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : FR824239
1 UniProt : F0WQ48
1 UniProt : F0WQ48
1 Interpro : F0WQ48
1 Prodom : F0WQ48
1 Pfam : F0WQ48
1 PIRSF : F0WQ48
1 SUPERFAM : F0WQ48
Sequence
Graphical view for this peptide sequence: 9stra-f0wq48
Colored MSA for Prolylcarboxypeptidase (raw)
KELSFKQRLDHFNVAQNASFPQRYFFCDPYELNAAIDAVFFYLGNEAEVT
LYLNHTGWMWENAWEFKAALIFAEHRYFGRSIPFPKESIRQNMGFLSSEQ
ALADYAALITSIKQNRTHLQRAPFIGFGGSYGGMLAAWFRVKYPHIIDGV
IAASAPVLAFMGDQRPVDMEGFARVSTFDATMGAGASSNCASNIRQSWQS
MWKLSKTLQGREKLSKIFQLCNDAILHSEKDAEAMIMWAKEAFDYMSMGN
YPYPTSYIMNGESTLPSYPVRVACGFLSDAFVVPKEEDTLLEAFVRSIGV
YYNSTKQKSCHDMKPASEKSRRDADFWDYIYCSELYMPSTTDGIHDMFWP
VAWNQSEDNANCIKTWGVSLRPFWAVTQFGGLKALQRASNIVFSNGNYDP
WSATGVTKSISSSVVYIPVPGGAHHIDLFFSNDLDPPEVRKARQLERQNI
RRWIRRVSVSTLE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

KELSFKQRLDHFNVAQNASFPQRYFFCDPYELNAAIDAVFFYLGNEAEVT
LYLNHTGWMWENAWEFKAALIFAEHRYFGRSIPFPKESIRQNMGFLSSEQ
ALADYAALITSIKQNRTHLQRAPFIGFGGSYGGMLAAWFRVKYPHIIDGV
IAASAPVLAFMGDQRPVDMEGFARVSTFDATMGAGASSNCASNIRQSWQS
MWKLSKTLQGREKLSKIFQLCNDAILHSEKDAEAMIMWAKEAFDYMSMGN
YPYPTSYIMNGESTLPSYPVRVACGFLSDAFVVPKEEDTLLEAFVRSIGV
YYNSTKQKSCHDMKPASEKSRRDADFWDYIYCSELYMPSTTDGIHDMFWP
VAWNQSEDNANCIKTWGVSLRPFWAVTQFGGLKALQRASNIVFSNGNYDP
WSATGVTKSISSSVVYIPVPGGAHHIDLFFSNDLDPPEVRKARQLERQNI
RRWIRRVSVSTLE


Reference
    Title: Gene gain and loss during evolution of obligate parasitism in the white rust pathogen of Arabidopsis thaliana
    Kemen E, Gardiner A, Schultz-Larsen T, Kemen AC, Balmuth AL, Robert-Seilaniantz A, Bailey K, Holub E, Studholme DJ and Jones JD <1 more author(s)>
    Ref: PLoS Biol, 9:e1001094, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer