Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: acasc-a0a1s5r938

Acanthopagrus schlegelii (Black porgy). Lipoprotein lipase

Relationship
Family|Lipoprotein_Lipase
Block| L
Position in NCBI Life Tree|Acanthopagrus schlegelii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Actinopterygii: N E > Actinopteri: N E > Neopterygii: N E > Teleostei: N E > Osteoglossocephalai: N E > Clupeocephala: N E > Euteleosteomorpha: N E > Neoteleostei: N E > Eurypterygia: N E > Ctenosquamata: N E > Acanthomorphata: N E > Euacanthomorphacea: N E > Percomorphaceae: N E > Eupercaria: N E > Spariformes: N E > Sparidae: N E > Acanthopagrus: N E > Acanthopagrus schlegelii: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KX078571
1 UniProt : A0A1S5R938
1 UniProt : A0A1S5R938
1 Interpro : A0A1S5R938
1 Pfam : A0A1S5R938
1 PIRSF : A0A1S5R938
1 SUPERFAM : A0A1S5R938
Sequence
Graphical view for this peptide sequence: acasc-a0a1s5r938
Colored MSA for Lipoprotein_Lipase (raw)
MGKENISFLTVWIILGKIFATFSSDPEPTTGSSTGSSSSTVFVNTTITAT
PLPTTAEWITDYTDIVSKFSLRTADIPDDDMCYIVPGRPDTIKECEFNNE
TQSFIVIHGWTVTGMFESWVPKLVSALYEREPSANVIVVDWLTRANQHYP
TSAAYTKLVGRDVAKFVTWIQKELQLPWDRIHLLGYSLGAHVAGIAGDLT
ERKISRITGLDPAGPTFEHADNQNTLSRDDAQFVDVLHTNTRGSPDRSIG
IQRPVGDIDIYPNGGTFQPGCDIQNTLLGIALEGIKGLQNMDQLVKCSHE
RSIHLFIDSLLNIEQQSLAYRCNSKEAFNKGLCLSCRKNRCNKLGYNINK
VRRTRSTKMYLKTRDMMPYKVFHYQVKVHFFSKDPLSFTEQPMKISLYGT
HGEKEDISFVLPVLKGNTTLSFLITTDVDIGDLMIVKLRWEKDTIISWSD
WWGSSKFHIRKLRIKSGETQSKVIFSAKEGEFVYLVRGGADGEFVKSKED
NLSRKEKLMHKLKMRGSLFAQNDA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGKENISFLTVWIILGKIFATFSSDPEPTTGSSTGSSSSTVFVNTTITAT
PLPTTAEWITDYTDIVSKFSLRTADIPDDDMCYIVPGRPDTIKECEFNNE
TQSFIVIHGWTVTGMFESWVPKLVSALYEREPSANVIVVDWLTRANQHYP
TSAAYTKLVGRDVAKFVTWIQKELQLPWDRIHLLGYSLGAHVAGIAGDLT
ERKISRITGLDPAGPTFEHADNQNTLSRDDAQFVDVLHTNTRGSPDRSIG
IQRPVGDIDIYPNGGTFQPGCDIQNTLLGIALEGIKGLQNMDQLVKCSHE
RSIHLFIDSLLNIEQQSLAYRCNSKEAFNKGLCLSCRKNRCNKLGYNINK
VRRTRSTKMYLKTRDMMPYKVFHYQVKVHFFSKDPLSFTEQPMKISLYGT
HGEKEDISFVLPVLKGNTTLSFLITTDVDIGDLMIVKLRWEKDTIISWSD
WWGSSKFHIRKLRIKSGETQSKVIFSAKEGEFVYLVRGGADGEFVKSKED
NLSRKEKLMHKLKMRGSLFAQNDA


Reference
    Title: Regulation of growth, antioxidant capacity, fatty acid profiles, hematological characteristics and expression of lipid related genes by different dietary n-3 highly unsaturated fatty acids in juvenile black seabream (Acanthopagrus schlegelii)
    Jin M, Lu Y, Yuan Y, Li Y, Qiu H, Sun P, Ma H-N, Ding L-Y, Zhou Q-C
    Ref: Aquaculture, 471:55, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer