Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: achxa-e3hjn2

Achromobacter xylosoxidans (strains A8; C54) Alpha/beta hydrolase fold family protein 4

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Achromobacter xylosoxidans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Alcaligenaceae: N E > Achromobacter: N E > Achromobacter xylosoxidans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : CP002287, ACRC01000665
1 UniProt : E3HJN2
1 UniProt : E3HJN2
1 Interpro : E3HJN2
1 Pfam : E3HJN2
1 PIRSF : E3HJN2
1 SUPERFAM : E3HJN2
Sequence
Graphical view for this peptide sequence: achxa-e3hjn2
Colored MSA for abh_upf0017 (raw)
MAAARLDTTPCPVPSWLPGGDSQTVYAALFAQYHRIAFVRERVDTPDTDF
VDFDWTGPGLFPHKSADGAPVSGQRPVANGKTAAARWMTDADWKSLPHTP
DTPALILFHGLEGGSNSRYAQSIAHHFRARGWIVVIAHFRGCSGVPNRLA
RAYYSGDSAEVGFMLETVRQRIPHARWHAVGVSLGGNALLKYLGEHQEDT
GWLTACAGVSVPLDLVACGKTLSTGMFNRRVYTAHFLKTLKHKVLEKAHR
YPGAVDVMRIAHAHDLREFDDTYTAPMHGFRNALDYWTRASSKPWLPKIS
VPTLVLNARNDPFVPAASLPTPEDCSPAILLHQPTDGGHAGFPTGSFPAH
LNWLPQRLGRFFETGQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAARLDTTPCPVPSWLPGGDSQTVYAALFAQYHRIAFVRERVDTPDTDF
VDFDWTGPGLFPHKSADGAPVSGQRPVANGKTAAARWMTDADWKSLPHTP
DTPALILFHGLEGGSNSRYAQSIAHHFRARGWIVVIAHFRGCSGVPNRLA
RAYYSGDSAEVGFMLETVRQRIPHARWHAVGVSLGGNALLKYLGEHQEDT
GWLTACAGVSVPLDLVACGKTLSTGMFNRRVYTAHFLKTLKHKVLEKAHR
YPGAVDVMRIAHAHDLREFDDTYTAPMHGFRNALDYWTRASSKPWLPKIS
VPTLVLNARNDPFVPAASLPTPEDCSPAILLHQPTDGGHAGFPTGSFPAH
LNWLPQRLGRFFETGQ


Reference
    Title: Complete genome sequence of the haloaromatic acid-degrading bacterium Achromobacter xylosoxidans A8
    Strnad H, Ridl J, Paces J, Kolar M, Vlcek C, Paces V
    Ref: Journal of Bacteriology, 193:791, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer