Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: achxa-e3hx77

Achromobacter xylosoxidans (strain A8) Carboxylesterase family protein

Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Achromobacter xylosoxidans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Alcaligenaceae: N E > Achromobacter: N E > Achromobacter xylosoxidans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP002287
1 UniProt : E3HX77
1 UniProt : E3HX77
1 Interpro : E3HX77
1 Pfam : E3HX77
1 PIRSF : E3HX77
1 SUPERFAM : E3HX77
Sequence
Graphical view for this peptide sequence: achxa-e3hx77
Colored MSA for Carb_B_Bacteria (raw)
MSQLVEAALQAGTLTGVQQGGVCRYSAIPYAQAPIGRLRFAPPQPAAWRG
KLDATRPGPVAPQLPSRLRGAMGDFNAEQSEDCLHLTVWTPAADGKRRPV
VVWLHGGAWQSGGGALDWYDGANLALRGDLVVVAVNYRLAALGWLYVPGQ
TANAGLLDQEAAIAWVLDNIQDLGGDPERLTVMGQSAGASSICAMLARKP
RFSRAILQSAALGRGFRSAKQADALGQAFLRAAGADSLEAARELPVTALL
AAQQAPAVAEVLRAEGSSRSQFAPVLDGQVLPQDIAPALEQAASRADVVV
CYTRDEMAAFPGNGRDASDQELGDEVFGAPSRQWARDAAAQGRQAWLARF
DVAPTANFGACHCIELPFVFDTMPAYAGAPMLAGLPPAQARQLAQATQQA
WIAFIRGDGPGWPAAPHMQILA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSQLVEAALQAGTLTGVQQGGVCRYSAIPYAQAPIGRLRFAPPQPAAWRG
KLDATRPGPVAPQLPSRLRGAMGDFNAEQSEDCLHLTVWTPAADGKRRPV
VVWLHGGAWQSGGGALDWYDGANLALRGDLVVVAVNYRLAALGWLYVPGQ
TANAGLLDQEAAIAWVLDNIQDLGGDPERLTVMGQSAGASSICAMLARKP
RFSRAILQSAALGRGFRSAKQADALGQAFLRAAGADSLEAARELPVTALL
AAQQAPAVAEVLRAEGSSRSQFAPVLDGQVLPQDIAPALEQAASRADVVV
CYTRDEMAAFPGNGRDASDQELGDEVFGAPSRQWARDAAAQGRQAWLARF
DVAPTANFGACHCIELPFVFDTMPAYAGAPMLAGLPPAQARQLAQATQQA
WIAFIRGDGPGWPAAPHMQILA


Reference
    Title: Complete genome sequence of the photosynthetic purple nonsulfur bacterium Rhodobacter capsulatus SB 1003
    Strnad H, Lapidus A, Paces J, Ulbrich P, Vlcek C, Paces V, Haselkorn R
    Ref: Journal of Bacteriology, 192:3545, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer