Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aciba-AB3403

Acinetobacter baumannii Non-ribosomal peptide synthetase (thioesterase domain)

Comment
There are more than 50 strains. Other Uniprot entries and list of strains can be found with the link: Other strains


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Acinetobacter baumannii
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Moraxellaceae: N E > Acinetobacter: N E > Acinetobacter calcoaceticus/baumannii complex: N E > Acinetobacter baumannii: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 4ZXH, 4ZXI
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: aciba-AB3403
Colored MSA for Thioesterase (raw)
EQSNDYVAPRDPIEIELCTTFEQILSVKRVGIHDDFFELGGHSLLAVKLV
NHLKKAFGTELSVALLAQYTVERLGEIIRENKEIKPSIVIELRRGTYEQP
LWLFHPIGGSTFCYMELSRHLNPNRTLRAIQSPGLIEADAAEVAIEEMAT
LYIAEMQKMQPQGPYFLGGWCFGGAIAYEISRQLRQMGQQVTGIVMIDTR
APIPENVPEDADDAMLLSWFARDLAAPYGKKLTIPAQYLRELSPDQMFDH
VLKEAKAINVLPLDADPSDFRLYFDTYLANGIALQTYFPEPEDFPILLVK
AKDEQEDFGESLGWDQLVKDTLTQVDLPGDHSSIMYAENVVAVAQTIDQM
YPIP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

EQSNDYVAPRDPIEIELCTTFEQILSVKRVGIHDDFFELGGHSLLAVKLV
NHLKKAFGTELSVALLAQYTVERLGEIIRENKEIKPSIVIELRRGTYEQP
LWLFHPIGGSTFCYMELSRHLNPNRTLRAIQSPGLIEADAAEVAIEEMAT
LYIAEMQKMQPQGPYFLGGWCFGGAIAYEISRQLRQMGQQVTGIVMIDTR
APIPENVPEDADDAMLLSWFARDLAAPYGKKLTIPAQYLRELSPDQMFDH
VLKEAKAINVLPLDADPSDFRLYFDTYLANGIALQTYFPEPEDFPILLVK
AKDEQEDFGESLGWDQLVKDTLTQVDLPGDHSSIMYAENVVAVAQTIDQM
YPIP


Reference
    Title: Structures of two distinct conformations of holo-non-ribosomal peptide synthetases
    Drake EJ, Miller BR, Shi C, Tarrasch JT, Sundlov JA, Allen CL, Skiniotis G, Aldrich CC, Gulick AM
    Ref: Nature, 529:235, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer