Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: alcfa-phb

Alcaligenes faecalis depolymerase

Comment
only n-term Pfam A Esterase_phd 57 276 Extracellular dPHASCL depolymerises (catalytic domain type 1)


Relationship
Family|Esterase_phb
Block| X
Position in NCBI Life Tree|Alcaligenes faecalis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Alcaligenaceae: N E > Alcaligenes: N E > Alcaligenes faecalis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : J04223
1 UniProt : P12625
1 UniProt : P12625
1 Interpro : P12625
1 Pfam : P12625
1 PIRSF : P12625
1 SUPERFAM : P12625
Sequence
Graphical view for this peptide sequence: alcfa-phb
Colored MSA for Esterase_phb (raw)
MVRRLWRRIAGWLAACVAILCAFPLHAATAGPGAWSSQQTWAADSVNGGN
LTGYFYWPASQPTTPNGKRALVLVLHGCVQTASGDVIDNANGAGFNWKSV
ADQYGAVILAPNATGNVYSNHCWDYANASPSRTAGHVGVLLDLVNRFVTN
SQYAIDPNQVYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTAQ
IGYVPSGFTATTAANKCNAWAGSNAGKFSTQIAGAVWGTSDYTVAQAYGP
MDAAAMRLVYGGNFTQGSQVSISGGGTNTPYTDSNGKVRTHEISVSGMAH
AWPAGTGGDNTNYVDATHINYPVFVMDYWVKNNLRAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVRRLWRRIAGWLAACVAILCAFPLHAATAGPGAWSSQQTWAADSVNGGN
LTGYFYWPASQPTTPNGKRALVLVLHGCVQTASGDVIDNANGAGFNWKSV
ADQYGAVILAPNATGNVYSNHCWDYANASPSRTAGHVGVLLDLVNRFVTN
SQYAIDPNQVYVAGLSSGGGMTMVLGCIAPDIFAGIGINAGPPPGTTTAQ
IGYVPSGFTATTAANKCNAWAGSNAGKFSTQIAGAVWGTSDYTVAQAYGP
MDAAAMRLVYGGNFTQGSQVSISGGGTNTPYTDSNGKVRTHEISVSGMAH
AWPAGTGGDNTNYVDATHINYPVFVMDYWVKNNLRAG


References
    Title: Proposed acquisition of an animal protein domain by bacteria
    Bork P, Doolittle RF
    Ref: Proc Natl Acad Sci U S A, 89:8990, 1992 : PubMed

            

    Title: Cloning, nucleotide sequence, and expression in Escherichia coli of the gene for poly(3-hydroxybutyrate) depolymerase from Alcaligenes faecalis
    Saito T, Suzuki K, Yamamoto J, Fukui T, Miwa K, Tomita K, Nakanishi S, Odani S, Suzuki J, Ishikawa K
    Ref: Journal of Bacteriology, 171:184, 1989 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer