Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: altal-a0a177d4p0

Alternaria alternata (Alternaria rot fungus) (Torula alternata). Carboxylic ester hydrolase

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Alternaria alternata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > dothideomyceta: N E > Dothideomycetes: N E > Pleosporomycetidae: N E > Pleosporales: N E > Pleosporineae: N E > Pleosporaceae: N E > Alternaria: N E > Alternaria alternata group: N E > Alternaria alternata: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KV441504
1 UniProt : A0A177D4P0
1 UniProt : A0A177D4P0
1 Interpro : A0A177D4P0
1 Pfam : A0A177D4P0
1 PIRSF : A0A177D4P0
1 SUPERFAM : A0A177D4P0
Sequence
Graphical view for this peptide sequence: altal-a0a177d4p0
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MKHFQQLLAAGAGFSSVAHAVNTLVDVGYAKYQGAVVDSELGVSAWKGIQ
YGAPPTGERRFAAPQDPIVSGFINATRHGATCPPSRPDDWTVSGTNDRFT
IAEDCLYLSVYAPSKARVDSKLPVVVFFQGGGFSSQSSANWDPTEIVADG
QVVFVQFSYRVGLYGFLSSEAVKAGGGDVNAGLRDQIKLLEWVKEHIDQF
GGDPDHVVLDGVSAGGSSVALMMAANTGKKLFAGGIMESGGWVTMRTPEL
GEEQYQCLLEDKGCANATDGLSCLRALNESAIRSSNCWFNPNIDGDLYTD
SLVNLFDQGKYAKVPTIMGTCAQEGTKYNAPEDLNTTADAVKWVANQDPS
LSNSSISIIDDLYMKPAKPSFPGKGLHWRHAADAIGDIGTHCPTRNIQNA
IARDDVPTYNYKYAVQDPADEAAGYGAWHTVNAYAFWGVNRTDGGEPPSY
FTTNAPIIKQVRSYWTSFIRNLDPNTDRANRAAEWKPYTGADSRERLFIQ
TNNTKMERMSPAQALRCDVVRPMSDNLGKPVGKGVVTEFDVELAKKVNGT
SESTAWKKGKKQARNFALHY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKHFQQLLAAGAGFSSVAHAVNTLVDVGYAKYQGAVVDSELGVSAWKGIQ
YGAPPTGERRFAAPQDPIVSGFINATRHGATCPPSRPDDWTVSGTNDRFT
IAEDCLYLSVYAPSKARVDSKLPVVVFFQGGGFSSQSSANWDPTEIVADG
QVVFVQFSYRVGLYGFLSSEAVKAGGGDVNAGLRDQIKLLEWVKEHIDQF
GGDPDHVVLDGVSAGGSSVALMMAANTGKKLFAGGIMESGGWVTMRTPEL
GEEQYQCLLEDKGCANATDGLSCLRALNESAIRSSNCWFNPNIDGDLYTD
SLVNLFDQGKYAKVPTIMGTCAQEGTKYNAPEDLNTTADAVKWVANQDPS
LSNSSISIIDDLYMKPAKPSFPGKGLHWRHAADAIGDIGTHCPTRNIQNA
IARDDVPTYNYKYAVQDPADEAAGYGAWHTVNAYAFWGVNRTDGGEPPSY
FTTNAPIIKQVRSYWTSFIRNLDPNTDRANRAAEWKPYTGADSRERLFIQ
TNNTKMERMSPAQALRCDVVRPMSDNLGKPVGKGVVTEFDVELAKKVNGT
SESTAWKKGKKQARNFALHY



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer