Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: anask-b4ujl9

Anaeromyxobacter sp. (strain K) Putative uncharacterized protein

Relationship
Family|ABHD18
Block| X
Position in NCBI Life Tree|Anaeromyxobacter sp. K
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > delta/epsilon subdivisions: N E > Deltaproteobacteria: N E > Myxococcales: N E > Cystobacterineae: N E > Anaeromyxobacteraceae: N E > Anaeromyxobacter: N E > Anaeromyxobacter sp. K: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001131
1 UniProt : B4UJL9
1 UniProt : B4UJL9
1 Interpro : B4UJL9
1 Pfam : B4UJL9
1 PIRSF : B4UJL9
1 SUPERFAM : B4UJL9
Sequence
Graphical view for this peptide sequence: anask-b4ujl9
Colored MSA for ABHD18 (raw)
MHVLDVLFGLTAAGPHFFADGWGDRRLVEKLRPLPLARRAPARIDVSLGP
PRAAQGGTLRDGCFRSPESRLPGCARAARIQVLLPAGPLRGVAVHLAASG
DQGFAIRLRFAAPLLAQGLGAIVLENAFYGARRPERQARHAVRSVSDLYL
MGAATFQEGRALLAWAREALGAPRVGVTGYSMGGQLAAMVGASMPFPVAT
VPLAPSCSPDSVLLSGVLRDVPDWAALAGRAADREAARRKLCAGLSRFSV
CALPPPAAPGAAIVVGTAADGVVPPAEMARIAAHWGCELRWLPAGHVSAV
LRHQGAMREAILDAFLRLEAAERELRPAAPGSAGSARRASSRARSRRAGP
RGRAPSRLR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHVLDVLFGLTAAGPHFFADGWGDRRLVEKLRPLPLARRAPARIDVSLGP
PRAAQGGTLRDGCFRSPESRLPGCARAARIQVLLPAGPLRGVAVHLAASG
DQGFAIRLRFAAPLLAQGLGAIVLENAFYGARRPERQARHAVRSVSDLYL
MGAATFQEGRALLAWAREALGAPRVGVTGYSMGGQLAAMVGASMPFPVAT
VPLAPSCSPDSVLLSGVLRDVPDWAALAGRAADREAARRKLCAGLSRFSV
CALPPPAAPGAAIVVGTAADGVVPPAEMARIAAHWGCELRWLPAGHVSAV
LRHQGAMREAILDAFLRLEAAERELRPAAPGSAGSARRASSRARSRRAGP
RGRAPSRLR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer