Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: antpo-q3kvm1

Antheraea polyphemus (Polyphemus moth) pheromone-degrading enzyme 1

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Antheraea polyphemus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Obtectomera: N E > Bombycoidea: N E > Saturniidae: N E > Saturniinae: N E > Saturniini: N E > Antheraea: N E > Antheraea polyphemus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY866480
1 UniProt : Q3KVM1
1 UniProt : Q3KVM1
1 Interpro : Q3KVM1
1 Pfam : Q3KVM1
1 PIRSF : Q3KVM1
1 SUPERFAM : Q3KVM1
Sequence
Graphical view for this peptide sequence: antpo-q3kvm1
Colored MSA for Carb_B_Arthropoda (raw)
MFLKLFIFVATVGLASTADSNPVVTVTQGALQGAWKTSAKGRDYASFQGV
PYAIPPTGEYRFKEPQELTSWDGTWNATEPLSACLQYDPFSDSITGNEDC
LYLNIHTPNISSDASLPVMVFIHGGAFMYGEGSVYDPIYFMDYDMVVITF
NYRLGPLGFLSTADDVIPGNNGLKDQSFALHWVKNNIKMFGGNPDSITLT
GCSAGGASVHYHYLSQLSRDTFHRGIAFSGSAFDPWAFAVKPVQNANTLA
SIVGCSSDTSTEILNCLMDASAEDIVNAQNEMFDWKVKLFSHFTPTIEAA
EVEDAFLNKYPYQAAVDGDMLNVPLITAMNAQEGLYPGAADLIYLDEIES
QWSVVARDLFKYNDTLSSTLWSDVAAKIKEEYFGDETVSEDTFSQLVEAL
TDRLFIMDIGRLAEIHALKSGQATYVYKYSYRATTSLSNLLANNEEDYGV
CHCDDVLHIFNYPYIDARTDTDLQMIYNLCEMIYTYASTGTPVMAGSDIE
WLPVTSGDSEINYLEIFSPNSTEMKSSSDFGRRSFWDNLGIIENKNYNAT
LIAEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFLKLFIFVATVGLASTADSNPVVTVTQGALQGAWKTSAKGRDYASFQGV
PYAIPPTGEYRFKEPQELTSWDGTWNATEPLSACLQYDPFSDSITGNEDC
LYLNIHTPNISSDASLPVMVFIHGGAFMYGEGSVYDPIYFMDYDMVVITF
NYRLGPLGFLSTADDVIPGNNGLKDQSFALHWVKNNIKMFGGNPDSITLT
GCSAGGASVHYHYLSQLSRDTFHRGIAFSGSAFDPWAFAVKPVQNANTLA
SIVGCSSDTSTEILNCLMDASAEDIVNAQNEMFDWKVKLFSHFTPTIEAA
EVEDAFLNKYPYQAAVDGDMLNVPLITAMNAQEGLYPGAADLIYLDEIES
QWSVVARDLFKYNDTLSSTLWSDVAAKIKEEYFGDETVSEDTFSQLVEAL
TDRLFIMDIGRLAEIHALKSGQATYVYKYSYRATTSLSNLLANNEEDYGV
CHCDDVLHIFNYPYIDARTDTDLQMIYNLCEMIYTYASTGTPVMAGSDIE
WLPVTSGDSEINYLEIFSPNSTEMKSSSDFGRRSFWDNLGIIENKNYNAT
LIAEL


Reference
    Title: Rapid inactivation of a moth pheromone
    Ishida Y, Leal WS
    Ref: Proc Natl Acad Sci U S A, 102:14075, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer