Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aquae-aq2138

Aquifex aeolicus aq_2138 gene

Relationship
Family|BioH
Block| X
Position in NCBI Life Tree|Aquifex aeolicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Aquificae [phylum]: N E > Aquificae [class]: N E > Aquificales: N E > Aquificaceae: N E > Aquifex: N E > Aquifex aeolicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AE000774, AE000657
1 Ncbi-nid : 2984324
1 Ncbi-pid : 2984337
1 UniProt : O67895
1 Interpro : O67895
1 Pfam : O67895
1 PIRSF : O67895
1 SUPERFAM : O67895
Sequence
Graphical view for this peptide sequence: aquae-aq2138
Colored MSA for BioH (raw)
MLKNPLFIHGWAFSSKVFNDFHGIKYDLPGHGKNKNPYESIEKVVEEIGK
IATSKHDVVGWSLGGSLALLFAYRYPEKVNRLILIGTTPHFKGAWSEKNI
RAMKLLIKKKGIKAFRELAYGKFEDFFDEEQGMRFLEDYVNLNLYTVLPY
IKKEVYLIHGVSDRIVPYSEAYKLHRALKCSKLILLGGGHFPVRNEEHLR
KAILKGY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLKNPLFIHGWAFSSKVFNDFHGIKYDLPGHGKNKNPYESIEKVVEEIGK
IATSKHDVVGWSLGGSLALLFAYRYPEKVNRLILIGTTPHFKGAWSEKNI
RAMKLLIKKKGIKAFRELAYGKFEDFFDEEQGMRFLEDYVNLNLYTVLPY
IKKEVYLIHGVSDRIVPYSEAYKLHRALKCSKLILLGGGHFPVRNEEHLR
KAILKGY


Reference
    Title: The complete genome of the hyperthermophilic bacterium Aquifex aeolicus
    Deckert G, Warren PV, Gaasterland T, Young WG, Lenox AL, Graham DE, Overbeek R, Snead MA, Keller M and Swanson RV <5 more author(s)>
    Ref: Nature, 392:353, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer