Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aradu-a0a6p4dix2

Arachis duranensis (Wild peanut); Arachis hypogaea (Peanut). protein EDS1L

Comment
Other strains: Arachis duranensis (Wild peanut); Arachis hypogaea (Peanut)


Relationship
Family|Plant_lipase_EDS1-like
Block| L
Position in NCBI Life Tree|Arachis duranensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > 50 kb inversion clade: N E > dalbergioids sensu lato: N E > Dalbergieae: N E > Pterocarpus clade: N E > Arachis: N E > Arachis duranensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: aradu-a0a6p4dix2
Colored MSA for Plant_lipase_EDS1-like (raw)
MAEGSLSDMIGVKDEVVKKACAAAVKANKSPEKPFVLEKIKVSSEAVNIF
AFPASWRVADLYVSNGKPFGETKINVEQFPSLRSIGNDEAALVNEASLTR
FQLVMSNHTLQNEVSKAITEGKQIIFTGHSSGASMANLITFWTLEEYLNP
NKNQHYRPPICITFGAPLIGNHIFSHATNRENWSRYFVHFVMRFDMVPRI
SLAPFTSIERMFGTILQLFATSRLSALDPTRASAASEFYTTVMRNAATVT
SHAACILKGSTNLLLETVTNFVDLSPYRPFGTFVFCAGNGQLTVIRNADA
VLQVLFHAAQTSDLSQVSEVAKSSILQHQIQNYEAELQDSLMMQNVVCLD
QLERLPLSADGSNSDVVTALDGLGMNPKARLCLRAAGELQKQKRRNEKKI
SREINTKALPSMNDLEEYKASCALNKGYFDAFKVQKEPRDFQANVKRLVL
AGVWDETIEMLKRYELPDDFEGKKDWIDLGTSFRRLVEPLDIANYYRHLK
NEDTGPYMIKARPKRYRYTQRWLEHANRTPKAVITESTFWAEVEELCSWT
STNKPFEDVKERVVQLEQNIKGWIQKGEITKDVLLRDPTFVNLWENLPRE
HKATTSCIANIIV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAEGSLSDMIGVKDEVVKKACAAAVKANKSPEKPFVLEKIKVSSEAVNIF
AFPASWRVADLYVSNGKPFGETKINVEQFPSLRSIGNDEAALVNEASLTR
FQLVMSNHTLQNEVSKAITEGKQIIFTGHSSGASMANLITFWTLEEYLNP
NKNQHYRPPICITFGAPLIGNHIFSHATNRENWSRYFVHFVMRFDMVPRI
SLAPFTSIERMFGTILQLFATSRLSALDPTRASAASEFYTTVMRNAATVT
SHAACILKGSTNLLLETVTNFVDLSPYRPFGTFVFCAGNGQLTVIRNADA
VLQVLFHAAQTSDLSQVSEVAKSSILQHQIQNYEAELQDSLMMQNVVCLD
QLERLPLSADGSNSDVVTALDGLGMNPKARLCLRAAGELQKQKRRNEKKI
SREINTKALPSMNDLEEYKASCALNKGYFDAFKVQKEPRDFQANVKRLVL
AGVWDETIEMLKRYELPDDFEGKKDWIDLGTSFRRLVEPLDIANYYRHLK
NEDTGPYMIKARPKRYRYTQRWLEHANRTPKAVITESTFWAEVEELCSWT
STNKPFEDVKERVVQLEQNIKGWIQKGEITKDVLLRDPTFVNLWENLPRE
HKATTSCIANIIV


Reference
    Title: The genome sequences of Arachis duranensis and Arachis ipaensis, the diploid ancestors of cultivated peanut
    Bertioli DJ, Cannon SB, Froenicke L, Huang G, Farmer AD, Cannon EK, Liu X, Gao D, Clevenger J and Ozias-Akins P <29 more author(s)>
    Ref: Nat Genet, 48:438, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer