Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-AT5G51180

Arabidopsis thaliana (Mouse-ear cress) hypothetical protein

Comment
Q9LU56 only some differences


Relationship
Family|Duf_676
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AY050875, AY091211, AB023044
2 UniProt : Q949V0, Q9LU56
2 Interpro : Q949V0, Q9LU56
2 Pfam : Q949V0, Q9LU56
2 PIRSF : Q949V0, Q9LU56
2 SUPERFAM : Q949V0, Q9LU56
1 Tair database : AT5G51180
Sequence
Graphical view for this peptide sequence: arath-AT5G51180
Colored MSA for Duf_676 (raw)
MEKHEEENGLCKAESVDGSLDVWSCQNSDSSSADHLVVMVHGILGSTDDW
KFGAEQFVKKMPDKVFVHCSEKNVSALTLDGVDVMGERLAAEVLDIIQRK
PNICKISFVAHSLGGLAARYAIGKLYKPANQEDVKDSVADSSQETPKGTI
CGLEAMNFITVATPHLGSMGNKQVPFLFGFSSIEKVAGLIIHWIFKRTGR
HLFLKDEEEGKPPLLRRMVEDTDDCHFISALRAFKRRVAYSNVGHDHVVG
WKTASIRRDSELPKWEDSLNEKYPHIVYEELCKACDMEDIPEGENHSDDI
EEEMIKGLSSVSWEKVDVSFHSSRQRFAAHSVIQVKNEDMHIEGADVIEH
IIDHFHA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEKHEEENGLCKAESVDGSLDVWSCQNSDSSSADHLVVMVHGILGSTDDW
KFGAEQFVKKMPDKVFVHCSEKNVSALTLDGVDVMGERLAAEVLDIIQRK
PNICKISFVAHSLGGLAARYAIGKLYKPANQEDVKDSVADSSQETPKGTI
CGLEAMNFITVATPHLGSMGNKQVPFLFGFSSIEKVAGLIIHWIFKRTGR
HLFLKDEEEGKPPLLRRMVEDTDDCHFISALRAFKRRVAYSNVGHDHVVG
WKTASIRRDSELPKWEDSLNEKYPHIVYEELCKACDMEDIPEGENHSDDI
EEEMIKGLSSVSWEKVDVSFHSSRQRFAAHSVIQVKNEDMHIEGADVIEH
IIDHFHA


Reference
    Title: Structural analysis of Arabidopsis thaliana chromosome 5. X. Sequence features of the regions of 3,076,755 bp covered by sixty P1 and TAC clones
    Sato S, Nakamura Y, Kaneko T, Katoh T, Asamizu E, Kotani H, Tabata S
    Ref: DNA Research, 7:31, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer