Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: arath-Q9LVS4

Arabidopsis thaliana (Mouse-ear cress) palmitoyl-protein thioesterase precursor-like At5g47350 MQL5.21

Comment
Q8LEY5 has the active site serine but Q9LVS4 does not


Relationship
Family|Palmitoyl-protein_thioesterase
Block| X
Position in NCBI Life Tree|Arabidopsis thaliana
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Arabidopsis: N E > Arabidopsis thaliana: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AB018117, AY085151
2 UniProt : Q9LVS4, Q8LEY5
2 Interpro : Q9LVS4, Q8LEY5
2 Prodom : Q9LVS4, Q8LEY5
2 Pfam : Q9LVS4, Q8LEY5
2 PIRSF : Q9LVS4, Q8LEY5
2 SUPERFAM : Q9LVS4, Q8LEY5
1 Tair database : At5g47350
Sequence
Graphical view for this peptide sequence: arath-Q9LVS4
Colored MSA for Palmitoyl-protein_thioesterase (raw)
MEKGLTMSCVLVVVAFLAMVHVSVSVPFVVFPEIGTQCSDAPNANFTQLL
SNLSSSPGFCIEIGEGNPIGASWLIPLTQQAEAACDKVTQMEELSQGYNI
VGRSQGNLVARGLIEFCEGGPSVHNYISLAGPHAGTANLLRCNTSGLICD
IANGIGKENPYSDFVQDNLAPSGYFKNPKNVTGYLKDCQYLPKLNNERPY
ERNTTYKDRFASLQNLVFVLFENDTVIVPKESSWFGFYPDGDLTHVLPVQ
ETKLYIEDWIGLKALVVAGKVQFVNVTGDHLIMADEDLVKYVVPLLQDQQ
SAAPRLNRKTKEPLHP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEKGLTMSCVLVVVAFLAMVHVSVSVPFVVFPEIGTQCSDAPNANFTQLL
SNLSSSPGFCIEIGEGNPIGASWLIPLTQQAEAACDKVTQMEELSQGYNI
VGRSQGNLVARGLIEFCEGGPSVHNYISLAGPHAGTANLLRCNTSGLICD
IANGIGKENPYSDFVQDNLAPSGYFKNPKNVTGYLKDCQYLPKLNNERPY
ERNTTYKDRFASLQNLVFVLFENDTVIVPKESSWFGFYPDGDLTHVLPVQ
ETKLYIEDWIGLKALVVAGKVQFVNVTGDHLIMADEDLVKYVVPLLQDQQ
SAAPRLNRKTKEPLHP


Reference
    Title: Structural analysis of Arabidopsis thaliana chromosome 5. X. Sequence features of the regions of 3,076,755 bp covered by sixty P1 and TAC clones
    Sato S, Nakamura Y, Kaneko T, Katoh T, Asamizu E, Kotani H, Tabata S
    Ref: DNA Research, 7:31, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer