(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Cyanobacteria/Melainabacteria group: NE > Cyanobacteria: NE > Oscillatoriophycideae: NE > Oscillatoriales: NE > Microcoleaceae: NE > Arthrospira: NE > Arthrospira platensis: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Arthrospira platensis NIES-39: N, E.
Arthrospira platensis str. Paraca: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MNNNQACNPVLLIHGIFDTIAIFRVMSKHLRQKGWEVHSFNLCPNYGLSS IECLAEQIVEYADQNFAPNQPFDLVGFSMGGIVSRYYVQKLGGIERVQRL ITISSPHNGTMTANFYPTKAAAQMRPNSPLLLDLNNNIGMLDRLNFTSIW TKFDLMIVPANSSHLNWGEEIILDVRLHAWMVKDPNCITAVEKALRTPLK FPQSKVI
A filamentous non-N(2)-fixing cyanobacterium, Arthrospira (Spirulina) platensis, is an important organism for industrial applications and as a food supply. Almost the complete genome of A. platensis NIES-39 was determined in this study. The genome structure of A. platensis is estimated to be a single, circular chromosome of 6.8 Mb, based on optical mapping. Annotation of this 6.7 Mb sequence yielded 6630 protein-coding genes as well as two sets of rRNA genes and 40 tRNA genes. Of the protein-coding genes, 78% are similar to those of other organisms; the remaining 22% are currently unknown. A total 612 kb of the genome comprise group II introns, insertion sequences and some repetitive elements. Group I introns are located in a protein-coding region. Abundant restriction-modification systems were determined. Unique features in the gene composition were noted, particularly in a large number of genes for adenylate cyclase and haemolysin-like Ca(2+)-binding proteins and in chemotaxis proteins. Filament-specific genes were highlighted by comparative genomic analysis.
