Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: artsp-hod

Arthrobacter sp. Arthrobacter ilicis Arthrobacter nitroguajacolicus RU61A hod gene 1h-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase (HOD) HodC

Comment
1h-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase (HOD) Oxygenases without requirement for cofactors or metal ions, catalyzing N-heterocyclic-ring cleavage and formation of carbon monoxide. Composed of a classical alpha/beta-hydrolase fold core domain with a cap domain. Organic substrates undergo selective deprotonation of their hydroxyl group by a His/Asp charge-relay system affording the generation of electron-donating species. The oxyanion hole of the alpha/beta-hydrolase fold, is utilized here to host and control oxygen chemistry involving a peroxide anion intermediate. Product release occurs by proton back transfer from the catalytic histidine.It is a non-nucleophilic general-base mechanism. Other strains: Arthrobacter sp. Arthrobacter ilicis Arthrobacter nitroguajacolicus RU61A


Relationship
Family|HOD-cofactorfree-dioxygenase
Block| X
Position in NCBI Life Tree|Arthrobacter sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Micrococcaceae: N E > Arthrobacter: N E > Arthrobacter sp.: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
7 structures (e.g. : 2WJ3, 2WJ4, 2WJ6... more)
No kinetic





2 substrates: 2-methyl-quinolin-4(1H)-one, N-acetylanthranilate
No inhibitor
>3 Genbank links 1 more: CAA75080, Y14778, AJ537472
2 UniProt : O31266, Q7WSQ7
1 Ncbi-nid : 3059084
1 Ncbi-pid : 2440027
>3 Structure links 4 more: 7OJM, 7OKZ, 4CFS
2 UniProt : O31266, Q7WSQ7
2 Interpro : O31266, Q7WSQ7
2 Prodom : O31266, Q7WSQ7
2 Pfam : O31266, Q7WSQ7
2 PIRSF : O31266, Q7WSQ7
2 SUPERFAM : O31266, Q7WSQ7
Sequence
Graphical view for this peptide sequence: artsp-hod
Colored MSA for HOD-cofactorfree-dioxygenase (raw)
MTDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQEL
DADFRVIVPNWRGHGLSPCEVPDFGYQEQVKDALEILDQLGVETFLPVSH
SHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWR
EGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNG
SPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPT
HFPAIDVPDRAAVHIREFATAIRQGQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTDTYLHETLVFDNKLSYIDNQRDTDGPAILLLPGWCHDHRVYKYLIQEL
DADFRVIVPNWRGHGLSPCEVPDFGYQEQVKDALEILDQLGVETFLPVSH
SHGGWVLVELLEQAGPERAPRGIIMDWLMWAPKPDFAKSLTLLKDPERWR
EGTHGLFDVWLDGHDEKRVRHHLLEEMADYGYDCWGRSGRVIEDAYGRNG
SPMQMMANLTKTRPIRHIFSQPTEPEYEKINSDFAEQHPWFSYAKLGGPT
HFPAIDVPDRAAVHIREFATAIRQGQ


References
7 more
    Title: Enzyme-Mediated Quenching of the Pseudomonas Quinolone Signal (PQS): A Comparison between Naturally Occurring and Engineered PQS-Cleaving Dioxygenases
    Arranz San Martin A, Vogel J, Wullich SC, Quax WJ, Fetzner S
    Ref: Biomolecules, 12:170, 2021 : PubMed

            

    Title: Structural basis for cofactor-independent dioxygenation of N-heteroaromatic compounds at the alpha/beta-hydrolase fold
    Steiner RA, Janssen HJ, Roversi P, Oakley AJ, Fetzner S
    Ref: Proc Natl Acad Sci U S A, 107:657, 2010 : PubMed

            

    Title: Gene cluster of Arthrobacter ilicis Ru61a involved in the degradation of quinaldine to anthranilate: characterization and functional expression of the quinaldine 4-oxidase qoxLMS genes
    Parschat K, Hauer B, Kappl R, Kraft R, Huttermann J, Fetzner S
    Ref: Journal of Biological Chemistry, 278:27483, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer