Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspfn-faec

Aspergillus flavus; Aspergillus arachidicola Ferulic acid esterase C

Comment
Other strains: Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JC12722 / SRRC 167); Aspergillus arachidicola; Aspergillus oryzae (strain 3.042)


Relationship
Family|FaeC
Block| X
Position in NCBI Life Tree|Aspergillus flavus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus flavus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: aspfn-faec
Colored MSA for FaeC (raw)
MIKSIILQAIMVLSTLTSVHGANSSGCGKQPTLVNGVHKINDREYILKVP
DNYNANKPHHLIFGLHWRGGNMNSVVNGESVEPWYGLETRAQGSAILVAP
NGRNAGWANTNGEDVALIDAIIKQVEDDLCIDQSSRFATGFSWGGGMSYA
LACARAKEFRAVSVLSGGVISGCEGGHDPIAYLGIHGISDPVLPFDGGVT
LANKFAANNGCQQAYVGKPGLGSHSSVQTDFKGCSRPVSFIAYDGGHDAA
PLGVGNPLAPDATWKFFMAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIKSIILQAIMVLSTLTSVHGANSSGCGKQPTLVNGVHKINDREYILKVP
DNYNANKPHHLIFGLHWRGGNMNSVVNGESVEPWYGLETRAQGSAILVAP
NGRNAGWANTNGEDVALIDAIIKQVEDDLCIDQSSRFATGFSWGGGMSYA
LACARAKEFRAVSVLSGGVISGCEGGHDPIAYLGIHGISDPVLPFDGGVT
LANKFAANNGCQQAYVGKPGLGSHSSVQTDFKGCSRPVSFIAYDGGHDAA
PLGVGNPLAPDATWKFFMAA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer