Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspfu-q5vjg8

Aspergillus fumigatus (Sartorya fumigata), Neosartorya fischeri carboxypeptidase 4

Comment
Other strains: Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) (Aspergillus fumigatus), Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) (Aspergillus fischerianus) Aspergillus fumigatus Af293


Relationship
Family|Carboxypeptidase_S10
Block| X
Position in NCBI Life Tree|Aspergillus fumigatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus fumigatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AY436354, AAHF01000018
>3 UniProt links 1 more: Q5VJG8, Q4W8Y5, A1DKU1
>3 UniProt links 1 more: Q5VJG8, Q4W8Y5, A1DKU1
>3 Interpro links 1 more: Q5VJG8, Q4W8Y5, A1DKU1
>3 Prodom links 1 more: Q5VJG8, Q4W8Y5, A1DKU1
>3 Pfam links 1 more: Q5VJG8, Q4W8Y5, A1DKU1
>3 PIRSF links 1 more: Q5VJG8, Q4W8Y5, A1DKU1
>3 SUPERFAM links 1 more: Q5VJG8, Q4W8Y5, A1DKU1
Sequence
Graphical view for this peptide sequence: aspfu-q5vjg8
Colored MSA for Carboxypeptidase_S10 (raw)
MHFAVIVITLLVASSAVALENPHRKAVRPIKLDHGHLKPRAVTVADDGGY
KYLNKQTQRFLVNGTGIPEVDFDVGESYAGTLPNTPAGNSSLFFWFFPSQ
NPKAHDEITIWLNGGPGCSSLDGLLQENGPFLWQSGTYKPIRNPYSWTNL
TNMVYVDQPAGTGFSPGPSTVNNEEDVARQFKSWFKHFVDTFNLHGRKVY
ITGESYAGQYIPYIASAMLDEKDKKYFNVKGIQINDPSINDDSVMIYAPA
VSHLNQYLNVFSLNDTFVKHINKRAEECGYNKFLDEAITYPPPKEFPVAP
DPSKNNCALWDDIVEAAYYVNPCFNFYHLTDFCPYLWDEMGFPSLAGGPN
NYFNRSDVQKALHVPPTDYSVCGETTIFAKGDQSVPSALGPLPSVIERTN
NVLIGHGWLDYLLFVNGSLATIQNMTWNGAQGFQHPPVEPLYVPYHYGLA
ELVTSTAPNPYTLNAGAGYLGTAHTERGLTFSTVYMAGHEIPQYTPGAAY
RQLEFLLGRIDNLSSPGSYTA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHFAVIVITLLVASSAVALENPHRKAVRPIKLDHGHLKPRAVTVADDGGY
KYLNKQTQRFLVNGTGIPEVDFDVGESYAGTLPNTPAGNSSLFFWFFPSQ
NPKAHDEITIWLNGGPGCSSLDGLLQENGPFLWQSGTYKPIRNPYSWTNL
TNMVYVDQPAGTGFSPGPSTVNNEEDVARQFKSWFKHFVDTFNLHGRKVY
ITGESYAGQYIPYIASAMLDEKDKKYFNVKGIQINDPSINDDSVMIYAPA
VSHLNQYLNVFSLNDTFVKHINKRAEECGYNKFLDEAITYPPPKEFPVAP
DPSKNNCALWDDIVEAAYYVNPCFNFYHLTDFCPYLWDEMGFPSLAGGPN
NYFNRSDVQKALHVPPTDYSVCGETTIFAKGDQSVPSALGPLPSVIERTN
NVLIGHGWLDYLLFVNGSLATIQNMTWNGAQGFQHPPVEPLYVPYHYGLA
ELVTSTAPNPYTLNAGAGYLGTAHTERGLTFSTVYMAGHEIPQYTPGAAY
RQLEFLLGRIDNLSSPGSYTA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer