Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: aspor-tan

Aspergillus oryzae (Yellow koji mold), Aspergillus flavus, AotanA tannase 30 kda subunit P78581

Comment
Other strains: Aspergillus oryzae (Yellow koji mold)(strain ATCC 42149 / RIB 40), Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167)


Relationship
Family|Tannase
Block| X
Position in NCBI Life Tree|Aspergillus oryzae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Aspergillus: N E > Aspergillus oryzae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Methyl-Gallate
No inhibitor
1 Genbank : D63338
3 UniProt : P78581, Q000I5, B8NYI5
3 UniProt : P78581, Q000I5, B8NYI5
3 Interpro : P78581, Q000I5, B8NYI5
3 Prodom : P78581, Q000I5, B8NYI5
3 Pfam : P78581, Q000I5, B8NYI5
3 PIRSF : P78581, Q000I5, B8NYI5
3 SUPERFAM : P78581, Q000I5, B8NYI5
Sequence
Graphical view for this peptide sequence: aspor-tan
Colored MSA for Tannase (raw)
MRQHSRMAVAALAAGANAASFTDVCTVSNVKAALPANGTLLGISMLPSAV
TANPLYNQSAGMGSTTTYDYCNVTVAYTHTGKGDKVVIKYAFPKPSDYEN
RFYVAGGGGFSLSSDATGGLAYGAVGGATDAGYDAFDNSYDEVVLYGNGT
INWDATYMFAYQALGEMTRIGKYITKGFYGQSSDSKVYTYYEGCSDGGRE
GMSQVQRWGEEYDGAITGAPAFRFAQQQVHHVFSSEVEQTLDYYPPPCEL
KKIVNATIAACDPLDGRTDGVVSRTDLCKLNFNLTSIIGEPYYCAAGTST
SLGFGFSNGKRSNVKRQAEGSTTSYQPAQNGTVTARGVAVAQAIYDGLHN
SKGERAYLSWQIASELSDAETEYNSDTGKWELNIPSTGGEYVTKFIQLLN
LDNLSDLNNVTYDTLVDWMNTGMVRYMDSLQTTLPDLTPFQSSGGKLLHY
HGESDPSIPAASSVHYWQAVRSVMYGDKTEEEALEALEDWYQFYLIPGAA
HCGTNSLQPGPYPENNMEIMIDWVENGNKPSRLNATVSSGTYAGETQMLC
QWPKRPLWRGNSSFDCVNDEKSIDSWTYEFPAFKVPVY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRQHSRMAVAALAAGANAASFTDVCTVSNVKAALPANGTLLGISMLPSAV
TANPLYNQSAGMGSTTTYDYCNVTVAYTHTGKGDKVVIKYAFPKPSDYEN
RFYVAGGGGFSLSSDATGGLAYGAVGGATDAGYDAFDNSYDEVVLYGNGT
INWDATYMFAYQALGEMTRIGKYITKGFYGQSSDSKVYTYYEGCSDGGRE
GMSQVQRWGEEYDGAITGAPAFRFAQQQVHHVFSSEVEQTLDYYPPPCEL
KKIVNATIAACDPLDGRTDGVVSRTDLCKLNFNLTSIIGEPYYCAAGTST
SLGFGFSNGKRSNVKRQAEGSTTSYQPAQNGTVTARGVAVAQAIYDGLHN
SKGERAYLSWQIASELSDAETEYNSDTGKWELNIPSTGGEYVTKFIQLLN
LDNLSDLNNVTYDTLVDWMNTGMVRYMDSLQTTLPDLTPFQSSGGKLLHY
HGESDPSIPAASSVHYWQAVRSVMYGDKTEEEALEALEDWYQFYLIPGAA
HCGTNSLQPGPYPENNMEIMIDWVENGNKPSRLNATVSSGTYAGETQMLC
QWPKRPLWRGNSSFDCVNDEKSIDSWTYEFPAFKVPVY


References
    Title: Mutational analysis of Kex2 recognition sites and a disulfide bond in tannase from Aspergillus oryzae
    Koseki T, Otsuka M, Mizuno T, Shiono Y
    Ref: Biochemical & Biophysical Research Communications, 482:1165, 2017 : PubMed

            

    Title: Biochemical characterization of Aspergillus oryzae native tannase and the recombinant enzyme expressed in Pichia pastoris
    Mizuno T, Shiono Y, Koseki T
    Ref: J Biosci Bioeng, 118:392, 2014 : PubMed

            

    Title: Cloning and sequencing of the gene encoding tannase and a structural study of the tannase subunit from Aspergillus oryzae
    Hatamoto O, Watarai T, Kikuchi M, Mizusawa K, Sekine H
    Ref: Gene, 175:215, 1996 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer