Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacce-r8lxe1

Bacillus cereus; Bacillus thuringiensis; Bacillus sp.; Bacillus bombysepticus str. Wang; Streptococcus pneumoniae Lipase

Comment
Other strains: Bacillus cereus (HuB13-1; ISP2954; Rock4-2; VD133; m1550; B4264; BAG4O-1; 172560W; VD184; F65185; AH1134; VD166; VD196; VD169; Rock1-15; VD156; BDRD-Cer4; VD045; VD200; VD014; ATCC 10876); Bacillus thuringiensis (kurstaki; aizawai; indiana; YBT-1518; tolworthi); Bacillus sp. (JKS001846; JH7; RZ2MS9; GeD10; 7_6_55CFAA_CT2; cl25; MB366; G3(2015)); Bacillus bombysepticus str. Wang; Streptococcus pneumoniae


Relationship
Family|Bacterial_lip_FamI.5
Block| L
Position in NCBI Life Tree|Bacillus cereus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus cereus group: N E > Bacillus cereus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: WP_000517064, ACK60194, WP_000517067
>3 UniProt links 40 more: R8LXE1, A0A0F6FNQ3, A0A1J7RRU7
>3 Interpro links 40 more: R8LXE1, A0A0F6FNQ3, A0A1J7RRU7
>3 Pfam links 40 more: R8LXE1, A0A0F6FNQ3, A0A1J7RRU7
>3 PIRSF links 40 more: R8LXE1, A0A0F6FNQ3, A0A1J7RRU7
>3 SUPERFAM links 40 more: R8LXE1, A0A0F6FNQ3, A0A1J7RRU7
Sequence
Graphical view for this peptide sequence: bacce-r8lxe1
Colored MSA for Bacterial_lip_FamI.5 (raw)
MGKLFLKICFFALVTVCSFAAKISYAEERQQNNYPIILVNGFAGWGREEM
LGVKYWGGVHDIQEDLKRNGYTVHTAAVGPVSSNWDRACELYAQISGGTV
DYGAVHAEKHGHNRFGRTYSGFAPNWSETNKVHLVGHSMGGQTIRTLVQL
LKEGSFEEKNYVKNHPDIKISPLFEGGKSYVHSVTTLATPHNGTTLADGS
LLLPFVKDLLITAASFGGNNNLSLYDFKLDQWGIKKNAGESFFQYSNRIL
NSSLWKNTKDISQWDLSTDGAKELNNWVKTQPDVYYLSYSGHASQAAPIT
GLHLPHITMNKLLMGNAFFLGSYARYEENRPLVDTSWWQNDGVVNTNSMI
APSSNVAVNNNGSLQIGKWNHIETKANWDHLDMVGLSVSDSLGFSSIQEF
YRTIAEKLSRLPK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGKLFLKICFFALVTVCSFAAKISYAEERQQNNYPIILVNGFAGWGREEM
LGVKYWGGVHDIQEDLKRNGYTVHTAAVGPVSSNWDRACELYAQISGGTV
DYGAVHAEKHGHNRFGRTYSGFAPNWSETNKVHLVGHSMGGQTIRTLVQL
LKEGSFEEKNYVKNHPDIKISPLFEGGKSYVHSVTTLATPHNGTTLADGS
LLLPFVKDLLITAASFGGNNNLSLYDFKLDQWGIKKNAGESFFQYSNRIL
NSSLWKNTKDISQWDLSTDGAKELNNWVKTQPDVYYLSYSGHASQAAPIT
GLHLPHITMNKLLMGNAFFLGSYARYEENRPLVDTSWWQNDGVVNTNSMI
APSSNVAVNNNGSLQIGKWNHIETKANWDHLDMVGLSVSDSLGFSSIQEF
YRTIAEKLSRLPK



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer