Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: baccu-a0a0a1xc63

Bactrocera cucurbitae (Melon fruit fly) (Dacus cucurbitae). Carboxylic ester hydrolase

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Bactrocera cucurbitae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Brachycera: N E > Muscomorpha: N E > Eremoneura: N E > Cyclorrhapha: N E > Schizophora: N E > Acalyptratae: N E > Tephritoidea: N E > Tephritidae: N E > Dacinae: N E > Dacini: N E > Zeugodacus [genus]: N E > Zeugodacus [subgenus]: N E > Zeugodacus cucurbitae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: baccu-a0a0a1xc63
Colored MSA for Carb_B_Arthropoda (raw)
MHIQILLLFITVFLAVLPPPNRAVDVSAFNDALIVNLPNGRIRGRDNEYF
YSYESIPYAEPPLGPLRFESPRPYTSNWTDTFDATREPIECMQWDQYKAG
ADKLHGVEDCLTVNIYKPKQPATADVADDGLPVLVLIHGGAFMFGSVRGN
GHENFMRSGRVIVVKMGYRLGPLGFLSTEDTVISGNFGMKDQRLALQWIK
ANIARFGGDPERIMVLGFSSGGVAVHLHILAQRNFTEYAKVAASFSGVAF
NPWAITHKTRERAFELAKNLNCPDVSTSKLIKECLQRKPAAAIVRGVRNF
LVFGYNPFTTFGPSIEDAAVEDAFLTRAPKQIVESGDFAQLPWLVSYSAQ
DGGYNAAELLQRMPRREELIEVFNDRWYDLAPYNLFYKDTMRTVEQMDDY
SVALKRRYLGEKEFSIDTYSNVLRMYTDVLFRNGVEQAIRLQRQYANSPI
YAYVYDNPAEEGIGEALAHRKDVKMGTVHGDDFFLIFNRAGRTKIRADEQ
IISQNFIRMLENFVAKSDELTFGDCKFVNNVGKEEYQLMFITKDNCINRS
IVNLPSF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHIQILLLFITVFLAVLPPPNRAVDVSAFNDALIVNLPNGRIRGRDNEYF
YSYESIPYAEPPLGPLRFESPRPYTSNWTDTFDATREPIECMQWDQYKAG
ADKLHGVEDCLTVNIYKPKQPATADVADDGLPVLVLIHGGAFMFGSVRGN
GHENFMRSGRVIVVKMGYRLGPLGFLSTEDTVISGNFGMKDQRLALQWIK
ANIARFGGDPERIMVLGFSSGGVAVHLHILAQRNFTEYAKVAASFSGVAF
NPWAITHKTRERAFELAKNLNCPDVSTSKLIKECLQRKPAAAIVRGVRNF
LVFGYNPFTTFGPSIEDAAVEDAFLTRAPKQIVESGDFAQLPWLVSYSAQ
DGGYNAAELLQRMPRREELIEVFNDRWYDLAPYNLFYKDTMRTVEQMDDY
SVALKRRYLGEKEFSIDTYSNVLRMYTDVLFRNGVEQAIRLQRQYANSPI
YAYVYDNPAEEGIGEALAHRKDVKMGTVHGDDFFLIFNRAGRTKIRADEQ
IISQNFIRMLENFVAKSDELTFGDCKFVNNVGKEEYQLMFITKDNCINRS
IVNLPSF


Reference
    Title: Reconstructing a comprehensive transcriptome assembly of a white-pupal translocated strain of the pest fruit fly Bactrocera cucurbitae
    Sim SB, Calla B, Hall B, DeRego T, Geib SM
    Ref: Gigascience, 4:14, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer