Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacli-bacc

Bacillus licheniformis Bacillus subtilis Thioesterase domain

Comment
Bacillus subtilis


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Bacillus licheniformis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus licheniformis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AF007865, DQ272494
2 UniProt : O68008, Q2XP38
2 UniProt : O68008, Q2XP38
2 Interpro : O68008, Q2XP38
2 Prodom : O68008, Q2XP38
2 Pfam : O68008, Q2XP38
2 PIRSF : O68008, Q2XP38
2 SUPERFAM : O68008, Q2XP38
Sequence
Graphical view for this peptide sequence: bacli-bacc
Colored MSA for Thioesterase (raw)
KNLFCFPPAASMGIAYMGLAKHLKQHSVYSFNFIPSANRIRKYADIIKNI
QGEGPYTLIGYSSGGILAFDVAKELNRQGYEVEDLIIIDSKYRTKAEKHQ
FTEEEYREEISKTFELEKYRDVEKLLSDYLVDLVMKSYVYIQNTVTTGAI
DGHISYIKSSDNQRGENMMMWEKATSKTFTVVQGAGTHMQMISKSHPDIL
ERNARLIHDIINKTVKI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

KNLFCFPPAASMGIAYMGLAKHLKQHSVYSFNFIPSANRIRKYADIIKNI
QGEGPYTLIGYSSGGILAFDVAKELNRQGYEVEDLIIIDSKYRTKAEKHQ
FTEEEYREEISKTFELEKYRDVEKLLSDYLVDLVMKSYVYIQNTVTTGAI
DGHISYIKSSDNQRGENMMMWEKATSKTFTVVQGAGTHMQMISKSHPDIL
ERNARLIHDIINKTVKI


Reference
    Title: The bacitracin biosynthesis operon of Bacillus licheniformis ATCC 10716: molecular characterization of three multi-modular peptide synthetases.
    Konz D, Klens A, Schoergendorfer K, Marahiel MA
    Ref: Chemistry & Biology, 4:927, 1997 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer