Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacmd-d5dhr4

Bacillus megaterium (strains DSM 319; ATCC 12872 / QMB1551) Monoacylglycerol lipase

Comment
Other strains: Bacillus megaterium (DSM 319; ATCC 12872 / QMB1551; WSH-002; NBRC 15308 = ATCC 14581)


Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Bacillus megaterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus megaterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: CP001982, CP001983, CP003017
3 UniProt : D5DHR4, D5DV37, A0A0B6A706
3 UniProt : D5DHR4, D5DV37, A0A0B6A706
3 Interpro : D5DHR4, D5DV37, A0A0B6A706
3 Prodom : D5DHR4, D5DV37, A0A0B6A706
3 Pfam : D5DHR4, D5DV37, A0A0B6A706
3 PIRSF : D5DHR4, D5DV37, A0A0B6A706
3 SUPERFAM : D5DHR4, D5DV37, A0A0B6A706
Sequence
Graphical view for this peptide sequence: bacmd-d5dhr4
Colored MSA for CarbLipBact_2 (raw)
MERYDVIQGAESFYYKGNDIGILVSHGFMGTPQSMEYIGKELAEKGFTVY
GLRLTGHGTHYYDIEQTTYQKWKQDFLTGYQRLKQECRHVFILGQSMGGT
LTFHTASQGLDLDGVIAINPAITSIPSMEPYRSRHTPRYLKEEHPDIKDP
NVHEITYDKVPVRSMRELLSLMDETKERLSYVTCPALVLTSTVDNVVPPE
NSAYILNHIQSAEKRQHMLRNSYHVASMDFDKDTIVAQTAQFVQATVAKK
KVHERIF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MERYDVIQGAESFYYKGNDIGILVSHGFMGTPQSMEYIGKELAEKGFTVY
GLRLTGHGTHYYDIEQTTYQKWKQDFLTGYQRLKQECRHVFILGQSMGGT
LTFHTASQGLDLDGVIAINPAITSIPSMEPYRSRHTPRYLKEEHPDIKDP
NVHEITYDKVPVRSMRELLSLMDETKERLSYVTCPALVLTSTVDNVVPPE
NSAYILNHIQSAEKRQHMLRNSYHVASMDFDKDTIVAQTAQFVQATVAKK
KVHERIF


Reference
    Title: Complete genome sequence of the industrial strain Bacillus megaterium WSH-002
    Liu L, Li Y, Zhang J, Zou W, Zhou Z, Liu J, Li X, Wang L, Chen J
    Ref: Journal of Bacteriology, 193:6389, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer