Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacsu-FENB

Bacillus subtilis; Bacillus malacitensis; Bacillus [Brevibacterium] halotolerans fengycin synthetase

Comment
Other strains: Bacillus subtilis; Bacillus malacitensis; Bacillus [Brevibacterium] halotolerans


Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Bacillus subtilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Bacillus: N E > Bacillus subtilis group: N E > Bacillus subtilis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 2CB9, 2CBG
No kinetic





No Substrate
1 inhbitor:
PMSF
1 Genbank : L42523
2 Structure : 2CBG, 2CB9
1 UniProt : Q45563
1 Interpro : Q45563
1 Prodom : Q45563
1 Pfam : Q45563
1 PIRSF : Q45563
1 SUPERFAM : Q45563
Sequence
Graphical view for this peptide sequence: bacsu-FENB
Colored MSA for Thioesterase (raw)
ENRQDLTPPRNWVEQELTQIWKSVLGVKTIGIHDDFFALGGHSLKALQVI
HMLKHHQHVDIPIDVLFENPTIAQLAEKLYSNQLSAAGEQHVIQLNQQGG
KNLFCFPPISGFGIYFKDLALQLNHKAAVYGFHFIEEDSRIEQYVSRITE
IQPEGPYVLLGYSAGGNLAFEVVQAMEQKGLEVSDFIIVDAYKKDQSITA
DTENDDSAAYLPEAVRETVMQKKRCYQEYWAQLINEGRIKSNIHFIEAGI
QTETSGAMVLQKWQDAAEEGYAEYTGYGAHKDMLEGEFAEKNANIILNIL
DKINSDQKVLPNKH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ENRQDLTPPRNWVEQELTQIWKSVLGVKTIGIHDDFFALGGHSLKALQVI
HMLKHHQHVDIPIDVLFENPTIAQLAEKLYSNQLSAAGEQHVIQLNQQGG
KNLFCFPPISGFGIYFKDLALQLNHKAAVYGFHFIEEDSRIEQYVSRITE
IQPEGPYVLLGYSAGGNLAFEVVQAMEQKGLEVSDFIIVDAYKKDQSITA
DTENDDSAAYLPEAVRETVMQKKRCYQEYWAQLINEGRIKSNIHFIEAGI
QTETSGAMVLQKWQDAAEEGYAEYTGYGAHKDMLEGEFAEKNANIILNIL
DKINSDQKVLPNKH


References
    Title: The thioesterase domain of the fengycin biosynthesis cluster: a structural base for the macrocyclization of a non-ribosomal lipopeptide
    Samel SA, Wagner B, Marahiel MA, Essen LO
    Ref: Journal of Molecular Biology, 359:876, 2006 : PubMed

            

    Title: Transposon mutagenesis and cloning of the genes encoding the enzymes of fengycin biosynthesis in Bacillus subtilis.
    Chen CL, Chang LK, Chang YS, Liu ST, Tschen JS
    Ref: Molecular & General Genetics, 248:121, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer