Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bacth-pheC

Bacillus thermoglucosidasius; Geobacillus galactosidasius 2-hydroxymuconic semialdehyde hyd.(pheC)

Comment
Other strains: Bacillus thermoglucosidasius; Geobacillus galactosidasius


Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Bacillus thermoglucosidasius
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Parageobacillus: N E > Parageobacillus thermoglucosidasius: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF140605
1 Ncbi-nid : 7672522
1 Ncbi-pid : 7672529
2 UniProt : Q9LAF8, A0A226QHE9
2 Interpro : Q9LAF8, A0A226QHE9
2 Pfam : Q9LAF8, A0A226QHE9
2 PIRSF : Q9LAF8, A0A226QHE9
2 SUPERFAM : Q9LAF8, A0A226QHE9
Sequence
Graphical view for this peptide sequence: bacth-pheC
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MQEVTSTRIKTGAYETYFYRAGIGSSEAILFIHGSGPGATAWSNWQYALP
FFSEKEFDCIAPDLIGFGMSEHPSSPPKGIRSWMRLWVDQIKLLLDSLEI
KRTHLVGNSLGGAIALHLLAEAPERIDRVVLMGPAGAPFRLTRELDRIWG
FYEDPSKEAMAQMIRWFAYDESFIEDQLDNISKMRFEAAMNPAVRRSYEA
MFPPPRQQIVDDLVLPSATLRRIQQQVLLVHGLNDPIVPVETSYYLAQHL
PRVKMMIYGQCSHWTQVEHRDSFHSLLLSFFKDKI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQEVTSTRIKTGAYETYFYRAGIGSSEAILFIHGSGPGATAWSNWQYALP
FFSEKEFDCIAPDLIGFGMSEHPSSPPKGIRSWMRLWVDQIKLLLDSLEI
KRTHLVGNSLGGAIALHLLAEAPERIDRVVLMGPAGAPFRLTRELDRIWG
FYEDPSKEAMAQMIRWFAYDESFIEDQLDNISKMRFEAAMNPAVRRSYEA
MFPPPRQQIVDDLVLPSATLRRIQQQVLLVHGLNDPIVPVETSYYLAQHL
PRVKMMIYGQCSHWTQVEHRDSFHSLLLSFFKDKI


Reference
    Title: Phenol/cresol degradation by the thermophilic Bacillus thermoglucosidasius A7: cloning and sequence analysis of five genes involved in the pathway
    Duffner FM, Kirchner U, Bauer MP, Muller R
    Ref: Gene, 256:215, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer