Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: beab2-j4wat9

Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae) DltD domain-containing protein. thioesterase DcsB

Comment
Other strains: Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae) and (strain ARSEF 2860; D1-5) . The active site catalytic triad residues (S114, H276, and D247) (130,292, 263 in the full prot)


Relationship
Family|Thiohydrolase
Block| X
Position in NCBI Life Tree|Beauveria bassiana ARSEF 2860
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Hypocreales: N E > Cordycipitaceae: N E > Beauveria: N E > Beauveria bassiana: N E > Beauveria bassiana ARSEF 2860: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 7D78, 7D79
No kinetic





1 substrate:
GYO
No inhibitor
Sequence
Graphical view for this peptide sequence: beab2-j4wat9
Colored MSA for Thiohydrolase (raw)
MPAAAWSETHVATCAIMAPLSSFQVVECKTIDGIIIRGRFYAVDGKGPAI
IMTPGFNCVKEMLLPDIAETFQSQGFNTYIYDPRSIGDSDGSPKNLIDPL
QQAEDLADIVTHISSLPSVDSSKITLWGMSFGGTVSACAAAVDRRVKALV
MVCPILSFYQAEKRDKAFLQLIRDRQSQLRGNEPFMLPPFNSKGENPIGM
AGSGGPGGIEAYGFMGAVIDRGAPNFRNKIALQTYQKLAWWQPKEILKLV
DKTPVLMVTPELDTMSPPEEQKAAFELFPQTKKFLEAKGKGHLTVLSGEG
SVEVVDAMTEFIRENVAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPAAAWSETHVATCAIMAPLSSFQVVECKTIDGIIIRGRFYAVDGKGPAI
IMTPGFNCVKEMLLPDIAETFQSQGFNTYIYDPRSIGDSDGSPKNLIDPL
QQAEDLADIVTHISSLPSVDSSKITLWGMSFGGTVSACAAAVDRRVKALV
MVCPILSFYQAEKRDKAFLQLIRDRQSQLRGNEPFMLPPFNSKGENPIGM
AGSGGPGGIEAYGFMGAVIDRGAPNFRNKIALQTYQKLAWWQPKEILKLV
DKTPVLMVTPELDTMSPPEEQKAAFELFPQTKKFLEAKGKGHLTVLSGEG
SVEVVDAMTEFIRENVAG


Reference
    Title: A Polyketide Cyclase That Forms Medium-Ring Lactones
    Gao DW, Jamieson CS, Wang G, Yan Y, Zhou J, Houk KN, Tang Y
    Ref: Journal of the American Chemical Society, 143:80, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer