Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: biflo-BL0186

Bifidobacterium longum possible esterase

Relationship
Family|BD-FAE
Block| H
Position in NCBI Life Tree|Bifidobacterium longum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Bifidobacteriales: N E > Bifidobacteriaceae: N E > Bifidobacterium: N E > Bifidobacterium longum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





3 substrates: Ethyl-ferulate, Methyl-caffeate, Methyl-ferulate
No inhibitor
2 Genbank : AE014636, ALO73425
1 UniProt : Q8G7R1
1 Interpro : Q8G7R1
1 Prodom : Q8G7R1
1 Pfam : Q8G7R1
1 PIRSF : Q8G7R1
1 SUPERFAM : Q8G7R1
Sequence
Graphical view for this peptide sequence: biflo-BL0186
Colored MSA for BD-FAE (raw)
MDIKPWEYADFPAFNEPVPGATRVPTTGDEIGVTYHPDVPYATAGTTPLH
LQILVPQTRNQTDATTYPCMVHVQGSAWMKQDRTALVPTLSRIAERGFVV
AIVEYRHSGIASFPAQIQDARNAVRFMRANAAQYHADADNLFLSGCSSGG
QVALLAAVAHAADRTDMDDTSLSLAPNAADVSDATRGVIDYFGAVNGQMD
DGFPSTVDHHLATSPEGMMMGHVDLRDRPDLRAAMTVESYLTPELALPPV
LILHGTKDRLVNARQSASLYRRLRDVGKSAELYLLEGADHGGAEFWTDGM
CRVATDFMRSNCAR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDIKPWEYADFPAFNEPVPGATRVPTTGDEIGVTYHPDVPYATAGTTPLH
LQILVPQTRNQTDATTYPCMVHVQGSAWMKQDRTALVPTLSRIAERGFVV
AIVEYRHSGIASFPAQIQDARNAVRFMRANAAQYHADADNLFLSGCSSGG
QVALLAAVAHAADRTDMDDTSLSLAPNAADVSDATRGVIDYFGAVNGQMD
DGFPSTVDHHLATSPEGMMMGHVDLRDRPDLRAAMTVESYLTPELALPPV
LILHGTKDRLVNARQSASLYRRLRDVGKSAELYLLEGADHGGAEFWTDGM
CRVATDFMRSNCAR


References
    Title: Characterisation of a Hydroxycinnamic Acid Esterase From the Bifidobacterium longum subsp. longum Taxon
    Kelly SM, O'Callaghan J, Kinsella M, van Sinderen D
    Ref: Front Microbiol, 9:2690, 2018 : PubMed

            

    Title: The genome sequence of Bifidobacterium longum reflects its adaptation to the human gastrointestinal tract
    Schell MA, Karmirantzou M, Snel B, Vilanova D, Berger B, Pessi G, Zwahlen MC, Desiere F, Bork P and Arigoni F <2 more author(s)>
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 99:14422, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer