Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: blage-ACHE1

Blattella germanica; Blattella nipponica ace1 type acetylcholinesterase

Comment
Other strain: Blattella germanica; Blattella nipponica


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Blattella germanica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Polyneoptera: N E > Dictyoptera: N E > Blattodea: N E > Blaberoidea: N E > Ectobiidae: N E > Blattellinae: N E > Blattella: N E > Blattella germanica: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : DQ288249, ABB89946
1 UniProt : Q2PZG3
1 Ncbi-nid : 82754296
1 Ncbi-pid : 82754297
2 UniProt : Q2PZG3, A0A166AI58
2 Interpro : Q2PZG3, A0A166AI58
2 Prodom : Q2PZG3, A0A166AI58
2 Pfam : Q2PZG3, A0A166AI58
2 PIRSF : Q2PZG3, A0A166AI58
2 SUPERFAM : Q2PZG3, A0A166AI58
Sequence
Graphical view for this peptide sequence: blage-ACHE1
Colored MSA for ACHE (raw)
MDVGDLVGGLSVGSGDTDPLRDIHIREHVIKDHVHSHHGSGGGDPSYMSR
GDPSIVGRGEPMDMGRRDPPVDFGRRHSIDMDRVGHGGDPLDLAHESRMS
EEGSGHGMQDDPLVIDTKKGKVRGITLTAATGKLVDAWLGIPYAQKPLGP
LRFRHPRPVDRWDKHGEIYNATKMPNSCVQIIDTVFGDFPGALIWNPNTP
LSEDCLYINVVVPKPRPKNAAVMVWIFGGGFYSGSATLDVYDHKTLVSEE
NVIIVSMQYRVASLGFLFFDTIDVPGNAGLFDQLMALQWVHDNIQAFGGN
PNNVTLFGESAGAVSVSLHLLSPLSRNLFSQAIMESGSPTAPWAIISREE
SILRGLRLAEAVGCPRSRSDIRAVIDCLRKKNATDLVNNEWGTLGICEFP
FVPIIDGTILDGPPQRSLAEKNFKKTNILMGSNTEEGYYFIIYYLTELFR
KEENVYVNREEFLRSVQELNPYVNNVARQAIVFEYTDWLNPDDPIRNRDA
LDKMVGDYHFTCNVNEFAHRYAETGNNVYMYYFKHRSVGNPWPSWTGVMH
GDEINYVFGEPLNPAKNYQPQEIELSRRMMRYWANFAKTGNPSMSEDGTW
TATYWPVHTAYGREYLTLDVNSTETGRGPRLKQCAFWKKYLPQLIAVTSN
LNQQPESCPTDTSGAEMNKESSLLLICLVMKIILLWGPRGWV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDVGDLVGGLSVGSGDTDPLRDIHIREHVIKDHVHSHHGSGGGDPSYMSR
GDPSIVGRGEPMDMGRRDPPVDFGRRHSIDMDRVGHGGDPLDLAHESRMS
EEGSGHGMQDDPLVIDTKKGKVRGITLTAATGKLVDAWLGIPYAQKPLGP
LRFRHPRPVDRWDKHGEIYNATKMPNSCVQIIDTVFGDFPGALIWNPNTP
LSEDCLYINVVVPKPRPKNAAVMVWIFGGGFYSGSATLDVYDHKTLVSEE
NVIIVSMQYRVASLGFLFFDTIDVPGNAGLFDQLMALQWVHDNIQAFGGN
PNNVTLFGESAGAVSVSLHLLSPLSRNLFSQAIMESGSPTAPWAIISREE
SILRGLRLAEAVGCPRSRSDIRAVIDCLRKKNATDLVNNEWGTLGICEFP
FVPIIDGTILDGPPQRSLAEKNFKKTNILMGSNTEEGYYFIIYYLTELFR
KEENVYVNREEFLRSVQELNPYVNNVARQAIVFEYTDWLNPDDPIRNRDA
LDKMVGDYHFTCNVNEFAHRYAETGNNVYMYYFKHRSVGNPWPSWTGVMH
GDEINYVFGEPLNPAKNYQPQEIELSRRMMRYWANFAKTGNPSMSEDGTW
TATYWPVHTAYGREYLTLDVNSTETGRGPRLKQCAFWKKYLPQLIAVTSN
LNQQPESCPTDTSGAEMNKESSLLLICLVMKIILLWGPRGWV


References
    Title: Functional analysis and molecular characterization of two acetylcholinesterases from the German cockroach, Blattella germanica
    Kim YH, Choi JY, Je YH, Koh YH, Lee SH
    Ref: Insect Molecular Biology, 19:765, 2010 : PubMed

            

    Title: Molecular, biochemical and histochemical characterization of two acetylcholinesterase cDNAs from the German cockroach Blattella germanica
    Kim JI, Jung CS, Koh YH, Lee SH
    Ref: Insect Molecular Biology, 15:513, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer