Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: botpv-r1gcd4

Botryosphaeria parva (strain UCR-NP2) (Grapevine canker fungus) (Neofusicoccum parvum) Putative paraben-hydrolyzing esterase protein

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Botryosphaeria parva
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > dothideomyceta: N E > Dothideomycetes: N E > Dothideomycetes incertae sedis: N E > Botryosphaeriales: N E > Botryosphaeriaceae: N E > Neofusicoccum: N E > Neofusicoccum parvum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KB916820
1 UniProt : R1GCD4
1 UniProt : R1GCD4
1 Interpro : R1GCD4
1 Pfam : R1GCD4
1 PIRSF : R1GCD4
1 SUPERFAM : R1GCD4
Sequence
Graphical view for this peptide sequence: botpv-r1gcd4
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MPETIRVPYLKDLEYRGFIEGSTIKDKSSGKTLAHYFGGLPYGLPPIGPF
RWRAPRPLPPCYRYGTRANPGRFTGKTSMCPQGLPTWVKNAADNSSLWDE
DCMQCNIWIPAGDPPTGGWPVLFYIHGGFLQVGNPNEYNPVPLLSETPAS
FIIVMPAYRLNLFGFLASRELKAASSGEPVGNLGFWDQRLALEWTHKNIS
YFGGDAANITVAGYSAGSHSTFKQLAYDLYLPDAKAIIRRAIMWSNGPGM
QPKTLVAAQDQFDELCSALAIPSSLPGAEKVARLRALPPRQLLDAVPRMQ
RHQFRAVVDDEFVRADLYKDIDAGGFAARMRARGVALMMGECRDEHCLYG
TWYPPDDSLASLRERLCAEYPPPAVDVLVAHYYPRGRLPGACTDWRDAFG
RIYADMQVHCLERGFVDKLHAGGAGDLVYRYRVEWRLKCCDRFLPPDWGV
THTADKPIWWWGNGMDLTEGEKEVAWTALTGPYVKFVNGELGELRKEWGT
SGPRQVRRVDPDGKLSTWEDDMWDEGTGIWNKLRAVGATQAGRNIAESAK
L
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPETIRVPYLKDLEYRGFIEGSTIKDKSSGKTLAHYFGGLPYGLPPIGPF
RWRAPRPLPPCYRYGTRANPGRFTGKTSMCPQGLPTWVKNAADNSSLWDE
DCMQCNIWIPAGDPPTGGWPVLFYIHGGFLQVGNPNEYNPVPLLSETPAS
FIIVMPAYRLNLFGFLASRELKAASSGEPVGNLGFWDQRLALEWTHKNIS
YFGGDAANITVAGYSAGSHSTFKQLAYDLYLPDAKAIIRRAIMWSNGPGM
QPKTLVAAQDQFDELCSALAIPSSLPGAEKVARLRALPPRQLLDAVPRMQ
RHQFRAVVDDEFVRADLYKDIDAGGFAARMRARGVALMMGECRDEHCLYG
TWYPPDDSLASLRERLCAEYPPPAVDVLVAHYYPRGRLPGACTDWRDAFG
RIYADMQVHCLERGFVDKLHAGGAGDLVYRYRVEWRLKCCDRFLPPDWGV
THTADKPIWWWGNGMDLTEGEKEVAWTALTGPYVKFVNGELGELRKEWGT
SGPRQVRRVDPDGKLSTWEDDMWDEGTGIWNKLRAVGATQAGRNIAESAK
L


Reference
    Title: Draft Genome Sequence of Neofusicoccum parvum Isolate UCR-NP2, a Fungal Vascular Pathogen Associated with Grapevine Cankers
    Blanco-Ulate B, Rolshausen P, Cantu D
    Ref: Genome Announc, 1:, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer