bovin-ppt

 
Bos taurus palmitoyl-protein thioesterase mRNA, complete cds

Relationship
Block X
Bos taurus position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Cetartiodactyla: N E > Ruminantia: N E > Pecora: N E > Bovidae: N E > Bovinae: N E > Bos: N E > Bos taurus: N E

Molecular evidence
Database
No mutation
3 structures: 1EI9, 1EH5, 1EXW
No kinetic


Inhibitor: Palmitate , HDSF ,
2 Genbank : L34261, U89646
1 UniProt : P45478
1 Ncbi-nid : 533782
1 Ncbi-pid : 533783
3 Structure : 1EI9, 1EH5, 1EXW
2 UniProtTrembl : P45478, P79349
2 Interpro : P45478, P79349
2 Prodom : P45478, P79349
2 Pfam : P45478, P79349
2 PIRSF : P45478, P79349
2 SUPERFAM : P45478, P79349
2 QuickSwissBlast : P45478, P79349
 
Sequence
Graphical view for this peptide sequence: bovin-ppt
Colored MSA for Palmitoyl-protein_thioesterase (raw)
MASSSCLWLLALAFLLGSCASLALGHLDPPAPLPLVIWHGMGDSCCNPLS
MGAIKKMVEKKIPGIHVLSLEIGKTLREDVENSFFLNVNSQVTTVCQILA
KDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMVNLISVGGQHQGVFGLP
RCPGESSHICDFIRKTLNAGAYNKAIQERLVQAEYWHDPIREDIYRNHSI
FLADINQERGVNESYKKNLMALKKFVMVKFLNDTIVDPVDSEWFGFYRSG
QAKETIPLQESTLYTQDRLGLKAMDKAGQLVFLALEGDHLQLSEEWFYAH
IIPFLE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASSSCLWLLALAFLLGSCASLALGHLDPPAPLPLVIWHGMGDSCCNPLS
MGAIKKMVEKKIPGIHVLSLEIGKTLREDVENSFFLNVNSQVTTVCQILA
KDPKLQQGYNAMGFSQGGQFLRAVAQRCPSPPMVNLISVGGQHQGVFGLP
RCPGESSHICDFIRKTLNAGAYNKAIQERLVQAEYWHDPIREDIYRNHSI
FLADINQERGVNESYKKNLMALKKFVMVKFLNDTIVDPVDSEWFGFYRSG
QAKETIPLQESTLYTQDRLGLKAMDKAGQLVFLALEGDHLQLSEEWFYAH
IIPFLE

Graphical view for this nucleotide DNA sequence (2072 bp): bovin-ppt
>bovin-ppt
gggtcaagatggcgtcgtccagctgcttgtggctcttggctctcgctttc
ctgctgggttcctgcgcttccctggcgctggggcatctcgacccgccggc
tcccctgccgctggtgatctggcatgggatgggagacagctgttgtaatc
ccttaagtatgggtgctattaaaaaaatggttgagaagaaaatacctgga
attcacgtcttgtctttagagattgggaagactctcagagaggatgtgga
gaacagcttctttttgaatgtcaactcccaagtaacaacagtgtgtcaga
ttcttgctaaggatcctaaattgcagcaaggctacaatgctatgggattc
tcccagggaggccagtttctgcgggcagtggctcagagatgcccatcacc
tcccatggtcaacctcatctcagttgggggacaacatcaaggtgtttttg
gactccctcggtgcccaggagaaagctcacacatctgtgacttcatcaga
aaaacactgaacgctggggcttacaacaaggctatacaggaacgcctggt
gcaagcagaatactggcacgaccccatcagggaggacatataccgcaacc
acagcatcttcctggcagatattaatcaagagagaggtgtcaatgagtcc
tacaagaaaaacctgatggccctcaagaagtttgtgatggtgaaattcct
caatgataccattgtggaccctgtggattctgagtggtttggattttaca
gaagtggccaagccaaggagaccattcccttacaggagagcaccctatac
acacaggaccgcctggggctaaaggcaatggacaaggccggacagctggt
gttcctggctcttgaaggtgaccatcttcaactgtctgaagaatggtttt
acgcccacatcatacccttccttgagtgaaacccttgtagtctgaacccg
agctcagggaacccctcccactcccaaaccagttccctctatgcccaagc
ctgagctcagatccagctagcaactaatccttttctctagtcatcatcga
acatgccccgcttggaaagatccaagatacgaaccttaccctttgcctca
ccctgtcagcagatggtgctgaatgccaatgtaattagctgatagccgtg
gagcttgttttacagcctttgatatggccagactcttttaggaatcagga
gttcgctgcaggtcagtgccagagctttgcccaggcctggatgagactga
acaaactgaaccaatgaaatagtctaagatgagtgactttctcaggaaaa
tctagccacatctcaagccaaggggccagtactcaggcctgaggtattca
caaaaaatgctttaactgttctggtgatttgaccagtgctcggaaaagta
tcgcttggctaatgcatccatgtaatttctttacggctgtcctcctctga
gtatgttgctttctgtgtgtcttgggtattattttacaaattccggcagc
ccatgatcttgccttggtagcactgtctccttaggtagtgatgaattagt
tgctctgtcacaaaaggagggaagtagcacccaactggattgcttaaggc
aggaagtatacatattgcttaacttagatggggacgatagggaggtttaa
agaaaaatgtaaaaatttaaaaaggaggaggtagctggttctttccattc
cacccttgataaacctgtcccttctgaatatgactggtggtctggattcc
agaattactctattgctggcgttagcaaagaatgggagggggaaaaatat
gaacagatcaggctttctaacttccatctcaaaaatgtgtattaccagca
cactccaaactgcttctgatgtgttctgtgaaaaaaaaaaaaaaaaaaaa
aaaaaaaaaaaaagattgctcaagaaagcttagggaacattccatatccc
ttttctcttggagatcaacccaccttagactattaaggactcttttgaga
atttctgctaaagacaaccc



References
    Title: The crystal structure of palmitoyl protein thioesterase 1 and the molecular basis of infantile neuronal ceroid lipofuscinosis
    Bellizzi JJ, 3rd, Widom J, Kemp C, Lu JY, Das AK, Hofmann SL, Clardy J
    Ref: Proc Natl Acad Sci U S A, 97:4573, 2000 : PubMed

            

    Title: Lysosomal targeting of palmitoyl-protein thioesterase
    Verkruyse LA, Hofmann SL
    Ref: Journal of Biological Chemistry, 271:15831, 1996 : PubMed

            

    Title: Molecular cloning and expression of palmitoyl-protein thioesterase
    Camp LA, Verkruyse LA, Afendis SJ, Slaughter CA, Hofmann SL
    Ref: Journal of Biological Chemistry, 269:23212, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer