Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bpmd2-vg12

Mycobacterium phage D29 (Mycobacteriophage D29) Gp12

Relationship
Family|Lysin_B_C_ter
Block| X
Position in NCBI Life Tree|Mycobacterium phage D29
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> Viruses: N E > dsDNA viruses, no RNA stage: N E > Caudovirales: N E > Siphoviridae: N E > L5virus: N E > Mycobacterium virus D29: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
3HC7: Mycobacteriophage Lysin B is a novel mycolylarabinogalactan esterase.
No kinetic





1 substrate:
Cutin
No inhibitor
1 Genbank : AF022214
1 UniProt : O64205
1 Structure : 3HC7
1 UniProt : O64205
1 Interpro : O64205
1 Prodom : O64205
1 Pfam : O64205
1 PIRSF : O64205
1 SUPERFAM : O64205
Sequence
Graphical view for this peptide sequence: bpmd2-vg12
Colored MSA for Lysin_B_C_ter (raw)
MSKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMW
PSVEKGVAELILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHILPPT
GRLHRFLHRLKKVIFWGNPMRQKGFAHSDEWIHPVAAPDTLGILEDRLEN
LEQYGFEVRDYAHDGDMYASIKEDDLHEYEVAIGRIVMKASGFIGGRDSV
VAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPHLYNRYPAVEF
LRQI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSKPWLFTVHGTGQPDPLGPGLPADTARDVLDIYRWQPIGNYPAAAFPMW
PSVEKGVAELILQIELKLDADPYADFAMAGYSQGAIVVGQVLKHHILPPT
GRLHRFLHRLKKVIFWGNPMRQKGFAHSDEWIHPVAAPDTLGILEDRLEN
LEQYGFEVRDYAHDGDMYASIKEDDLHEYEVAIGRIVMKASGFIGGRDSV
VAQLIELGQRPITEGIALAGAIIDALTFFARSRMGDKWPHLYNRYPAVEF
LRQI


References
    Title: Mycobacteriophage Lysin B is a novel mycolylarabinogalactan esterase
    Payne K, Sun Q, Sacchettini J, Hatfull GF
    Ref: Molecular Microbiology, 73:367, 2009 : PubMed

            

    Title: Genome structure of mycobacteriophage D29: implications for phage evolution
    Ford ME, Sarkis GJ, Belanger AE, Hendrix RW, Hatfull GF
    Ref: Journal of Molecular Biology, 279:143, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer