Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: braja-BLL7862

Bradyrhizobium japonicum bll7862 protein

Relationship
Family|Homoserine_transacetylase_like_est
Block| X
Position in NCBI Life Tree|Bradyrhizobium japonicum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhizobiales: N E > Bradyrhizobiaceae: N E > Bradyrhizobium: N E > Bradyrhizobium japonicum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AP005963
1 UniProt : Q89CD5
1 Interpro : Q89CD5
1 Pfam : Q89CD5
1 PIRSF : Q89CD5
1 SUPERFAM : Q89CD5
Sequence
Graphical view for this peptide sequence: braja-BLL7862
Colored MSA for Homoserine_transacetylase_like_est (raw)
MHRHFSGAFCDRVSGVERMTAQRDYETFEAGDVTLQSGAIFPSMTLAYKT
YGTLSPAKDNVILYPTSFSAQHYDTEWLIGSGGVLDPERYFIIIPNLFGN
GLSSSPSNTAGPFPEPTYHDAIAVQHRLLTGRFGISKLALVYGWSMGGMQ
AYHWAASHPDMVERAAVVCGSARCAPYNHVFLESVKAALTGDPAFRNGRF
VEKPTVGYRAMGRVYAGWAMSHGFYRDELWREAGFSSLEDYLVRGWDATF
ARRDANDLLAQIGIWQSGDISRCAAFGGDLDRALAAIKAHMLLMPGATDR
YFDVRDNEDELGRLVNAKSAVLHPIPSLHGHRAGNPVNNPPDQAFIRAEI
AQLLSK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHRHFSGAFCDRVSGVERMTAQRDYETFEAGDVTLQSGAIFPSMTLAYKT
YGTLSPAKDNVILYPTSFSAQHYDTEWLIGSGGVLDPERYFIIIPNLFGN
GLSSSPSNTAGPFPEPTYHDAIAVQHRLLTGRFGISKLALVYGWSMGGMQ
AYHWAASHPDMVERAAVVCGSARCAPYNHVFLESVKAALTGDPAFRNGRF
VEKPTVGYRAMGRVYAGWAMSHGFYRDELWREAGFSSLEDYLVRGWDATF
ARRDANDLLAQIGIWQSGDISRCAAFGGDLDRALAAIKAHMLLMPGATDR
YFDVRDNEDELGRLVNAKSAVLHPIPSLHGHRAGNPVNNPPDQAFIRAEI
AQLLSK


Reference
    Title: Complete genomic sequence of nitrogen-fixing symbiotic bacterium Bradyrhizobium japonicum USDA110
    Kaneko T, Nakamura Y, Sato S, Minamisawa K, Uchiumi T, Sasamoto S, Watanabe A, Idesawa K, Iriguchi M and Tabata S <7 more author(s)>
    Ref: DNA Research, 9:189, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer