Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: burce-LLPE

Burkholderia cepacia (Pseudomonas cepacia), Burkholderia cenocepacia, Burkholderia ambifaria, Burkholderia multivorans, Burkholderia dolosa, lipase-like protein llpe

Comment
Other strains: Burkholderia cepacia ( J2315 / LMG 16656; ATCC 17760 / NCIB 9086 / R18194 (Burkholderia sp. 383); R1808 (Burkholderia vietnamiensis G4 / LMG 22486)), Burkholderia cenocepacia (HI2424; AU 1054; MC0-3; PC184); Burkholderia ambifaria (AMMD; MC40-6; MEX-5; IOP40-10), Burkholderia multivorans (CGD2M; CGD2; ATCC 17616 / 249; CGD1), Burkholderia dolosa AUO158; Burkholderia sp. TJI49


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Burkholderia cepacia
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia cepacia: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: burce-LLPE
Colored MSA for Hormone-sensitive_lipase_like (raw)
MDASEFSKFLKAALPAQAIAGAALTVAEVEIPGYAQDIVLRLYRRPDKTG
LPVVLYFHGGGFVRGSLEDADFAARFLAERLPALVVSVDYSLAPAFPFPA
APEDAYRAAVWAATRARAFGGNPKKIGVAGHDAGGQLANCLAFIARDRGE
VSIAAQALFGPMLDPSMTRIGDAERLASDITARECAACYRAYLPQAAQRM
HPYAAPIESVRLAGLPPTLVVTAQNDVLHVEAENYAGCLISSGVLTQVIR
YPDITHAALATHEAAFEEAVRFFQCRFQARQPNRPE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDASEFSKFLKAALPAQAIAGAALTVAEVEIPGYAQDIVLRLYRRPDKTG
LPVVLYFHGGGFVRGSLEDADFAARFLAERLPALVVSVDYSLAPAFPFPA
APEDAYRAAVWAATRARAFGGNPKKIGVAGHDAGGQLANCLAFIARDRGE
VSIAAQALFGPMLDPSMTRIGDAERLASDITARECAACYRAYLPQAAQRM
HPYAAPIESVRLAGLPPTLVVTAQNDVLHVEAENYAGCLISSGVLTQVIR
YPDITHAALATHEAAFEEAVRFFQCRFQARQPNRPE


References
    Title: Conservation of a novel protein associated with an antibiotic efflux operon in Burkholderia cenocepacia
    Nair BM, Joachimiak LA, Chattopadhyay S, Montano I, Burns JL
    Ref: FEMS Microbiology Letters, 245:337, 2005 : PubMed

            

    Title: Salicylate induces an antibiotic efflux pump in Burkholderia cepacia complex genomovar III (B. cenocepacia)
    Nair BM, Cheung KJ, Jr., Griffith A, Burns JL
    Ref: J Clinical Investigation, 113:464, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer