Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: bursp-deha

Burkholderia sp Fluoroacetate dehalogenase

Relationship
Family|Haloacetate_dehalogenase
Block| X
Position in NCBI Life Tree|Burkholderia sp.
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia sp.: N E


Molecular evidence
Database
No mutation
2 structures: 1Y37, 3B12
No kinetic





No Substrate
No inhibitor
1 Genbank : AB259121
1 UniProt : Q1JU72
2 Structure : 3B12, 1Y37
1 UniProt : Q1JU72
1 Interpro : Q1JU72
1 Prodom : Q1JU72
1 Pfam : Q1JU72
1 PIRSF : Q1JU72
1 SUPERFAM : Q1JU72
Sequence
Graphical view for this peptide sequence: bursp-deha
Colored MSA for Haloacetate_dehalogenase (raw)
MFEGFERRLVDVGDVTINCVVGGSGPALLLLHGFPQNLHMWARVAPLLAN
EYTVVCADLRGYGGSSKPVGAPDHANYSFRAMASDQRELMRTLGFERFHL
VGHDRGGRTGHRMALDHPDSVLSLAVLDIIPTYVMFEEVDRFVARAYWHW
YFLQQPAPYPEKVIGADPDTFYEGCLFGWGATGADGFDPEQLEEYRKQWR
DPAAIHGSCCDYRAGGTIDFELDHGDLGRQVQCPALVFSGSAGLMHSLFE
MQVVWAPRLANMRFASLPGGHFFVDRFPDDTARILREFLSDARSGIHQTE
RRES
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MFEGFERRLVDVGDVTINCVVGGSGPALLLLHGFPQNLHMWARVAPLLAN
EYTVVCADLRGYGGSSKPVGAPDHANYSFRAMASDQRELMRTLGFERFHL
VGHDRGGRTGHRMALDHPDSVLSLAVLDIIPTYVMFEEVDRFVARAYWHW
YFLQQPAPYPEKVIGADPDTFYEGCLFGWGATGADGFDPEQLEEYRKQWR
DPAAIHGSCCDYRAGGTIDFELDHGDLGRQVQCPALVFSGSAGLMHSLFE
MQVVWAPRLANMRFASLPGGHFFVDRFPDDTARILREFLSDARSGIHQTE
RRES


References
1 more
    Title: X-Ray crystallographic and mutational studies of fluoroacetate dehalogenase from Burkholderia sp. strain FA1
    Jitsumori K, Omi R, Kurihara T, Kurata A, Mihara H, Miyahara I, Hirotsu K, Esaki N
    Ref: Journal of Bacteriology, 191:2630, 2009 : PubMed

            

    Title: The catalytic mechanism of fluoroacetate dehalogenase: a computational exploration of biological dehalogenation
    Kamachi T, Nakayama T, Shitamichi O, Jitsumori K, Kurihara T, Esaki N, Yoshizawa K
    Ref: Chemistry, 15:7394, 2009 : PubMed

            

    Title: Purification, characterization, and gene cloning of a novel fluoroacetate dehalogenase from Burkholderia sp. FA1.
    Kurihara T, Yamauchi T, Ichiyama S, Takahata H, Esaki N
    Ref: J Mol Catal B Enzym, 23:347, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer