Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: caebe-g0m892

Caenorhabditis brenneri (Nematode worm) CBN-GLIT-1 protein

Relationship
Family|Gliotactin
Block| C
Position in NCBI Life Tree|Caenorhabditis brenneri
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Chromadorea: N E > Rhabditida: N E > Rhabditoidea: N E > Rhabditidae: N E > Peloderinae: N E > Caenorhabditis: N E > Caenorhabditis brenneri: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 28 more: GL379786, KF004972, KF004947
>3 UniProt links 15 more: G0M892, R9YUM9, R9YUK6
>3 UniProt links 15 more: G0M892, R9YUM9, R9YUK6
>3 Interpro links 15 more: G0M892, R9YUM9, R9YUK6
>3 Pfam links 15 more: G0M892, R9YUM9, R9YUK6
>3 PIRSF links 15 more: G0M892, R9YUM9, R9YUK6
>3 SUPERFAM links 15 more: G0M892, R9YUM9, R9YUK6
Sequence
Graphical view for this peptide sequence: caebe-g0m892
Colored MSA for Gliotactin (raw)
MYLGTIFHGLLTLPLVISQFIPPPTRPVNLWDPFETTTTPRPSGLNQGLN
RDEVVVRLPLGDIVGKEVHLRDLPWTINKDPTEELPRDGTHFDPNPLKPK
NNITVFTFLGVPYAEPPTSQRRFKPPQKLTVFPGKQPFLAFNFAASCAQD
VEKIPSPFVDHPYPFIVDEDCLYLNIYSPDISKNAPTTYPVIVFFHGGNF
QTGSANDWPAHGLASRGMVVVTVNYRLGAFGFMSLGDSDTGNYGLQDQRL
ALEFVRDHIATFGGDPQAVTVIGHDAGAASIGYHMQSPYSRHLFRSAATM
SGADVSYHSYIGKPALAFNNTVKLGRYVGCTETVPQHMWDCILGRSTNDI
VQATLTIPIEYNRYLFMPTVDGKELPGNPLWTLVNAPSGETSILSPVPML
IGMNAQDGSEVVLEDRRLGEYSQFNDVDHEYLKSYALEYCYRHNYSMNRE
ATADAILSKYTFWPDRAAVWAIKENFIQFATDAYYTAPMQLSAHLHSASG
SRVFQYVNNYNFSKQHPDLQFIPDWMGVCRDCDLYLMFGYPFLPDELRPI
GLRGINFTDMDRNASRTFSNIIRRFTYYQNPNFLYDGSWAAYEPRRHWYM
NFNYSHEEDWKVPGIIGRDYRYQDVAFWNEYIPALVNYMTTTFSPENVAY
RREITVYKWITGVNVIIIALLIVLAGAFGYMVFGNREEEEAVYKAESHQL
VDFREGGHSVSEVTISSRTRSPRSRVSNI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MYLGTIFHGLLTLPLVISQFIPPPTRPVNLWDPFETTTTPRPSGLNQGLN
RDEVVVRLPLGDIVGKEVHLRDLPWTINKDPTEELPRDGTHFDPNPLKPK
NNITVFTFLGVPYAEPPTSQRRFKPPQKLTVFPGKQPFLAFNFAASCAQD
VEKIPSPFVDHPYPFIVDEDCLYLNIYSPDISKNAPTTYPVIVFFHGGNF
QTGSANDWPAHGLASRGMVVVTVNYRLGAFGFMSLGDSDTGNYGLQDQRL
ALEFVRDHIATFGGDPQAVTVIGHDAGAASIGYHMQSPYSRHLFRSAATM
SGADVSYHSYIGKPALAFNNTVKLGRYVGCTETVPQHMWDCILGRSTNDI
VQATLTIPIEYNRYLFMPTVDGKELPGNPLWTLVNAPSGETSILSPVPML
IGMNAQDGSEVVLEDRRLGEYSQFNDVDHEYLKSYALEYCYRHNYSMNRE
ATADAILSKYTFWPDRAAVWAIKENFIQFATDAYYTAPMQLSAHLHSASG
SRVFQYVNNYNFSKQHPDLQFIPDWMGVCRDCDLYLMFGYPFLPDELRPI
GLRGINFTDMDRNASRTFSNIIRRFTYYQNPNFLYDGSWAAYEPRRHWYM
NFNYSHEEDWKVPGIIGRDYRYQDVAFWNEYIPALVNYMTTTFSPENVAY
RREITVYKWITGVNVIIIALLIVLAGAFGYMVFGNREEEEAVYKAESHQL
VDFREGGHSVSEVTISSRTRSPRSRVSNI


Reference
    Title: Molecular hyperdiversity defines populations of the nematode Caenorhabditis brenneri
    Dey A, Chan CK, Thomas CG, Cutter AD
    Ref: Proc Natl Acad Sci U S A, 110:11056, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer