Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: caeel-pafa

Caenorhabditis elegans platelet-activating factor acetylhydrolase homolog (EC 3.1.1.47)

Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Caenorhabditis elegans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Chromadorea: N E > Rhabditida: N E > Rhabditoidea: N E > Rhabditidae: N E > Peloderinae: N E > Caenorhabditis: N E > Caenorhabditis elegans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : U64598
1 UniProt : Q22943
1 UniProt : Q22943
1 Interpro : Q22943
1 Prodom : Q22943
1 Pfam : Q22943
1 PIRSF : Q22943
1 SUPERFAM : Q22943
1 WormBase : C52B9.7
1 WormBase Cosmid : C52B9

Sequence
Graphical view for this peptide sequence: caeel-pafa
Colored MSA for PAF-Acetylhydrolase (raw)
MSPRIRKGKKKERRMEIFGNFSSVQSEGRREEFLFTLNSLLLYFCKNFFR
NVLNNFIRESQTNFSYFYSLYTMGSYISSPQVLTRQVSGQFQVGCKDLMI
DGTVLGDRGLFMRLYFPTDSQAADISSYPLWLPKPQYAHGLGEYLGQSSQ
KMNVITSTVVGEKREDCIENAQMSTKCDKWPIVVFSHGLGGSRTFYSTYC
TSLASHGYVVAAVEHKWGKSGGRCDHVAFSCRDHSACWTYQLTEKNGELV
EQPIKIKLIEKNEKNEFKIRNQQVGKRVTECVKALNVLEQLNLGTVPEKV
LIGNDYNWAQFKNKLVMSSASVIGHSFGGATSLASSAYTTDFQKAIVFDG
WMYPLDSTQQEQAKQPTLFLNVGDWQWNENLDVMKKIISHNDGNLALTLN
GAVHQCFSDFPFIFPSWLAKKFGVQGRTEPSLCMQAAIELSLAFLENGKD
GAQKLKDEKFSSFISNEIYGREKYKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSPRIRKGKKKERRMEIFGNFSSVQSEGRREEFLFTLNSLLLYFCKNFFR
NVLNNFIRESQTNFSYFYSLYTMGSYISSPQVLTRQVSGQFQVGCKDLMI
DGTVLGDRGLFMRLYFPTDSQAADISSYPLWLPKPQYAHGLGEYLGQSSQ
KMNVITSTVVGEKREDCIENAQMSTKCDKWPIVVFSHGLGGSRTFYSTYC
TSLASHGYVVAAVEHKWGKSGGRCDHVAFSCRDHSACWTYQLTEKNGELV
EQPIKIKLIEKNEKNEFKIRNQQVGKRVTECVKALNVLEQLNLGTVPEKV
LIGNDYNWAQFKNKLVMSSASVIGHSFGGATSLASSAYTTDFQKAIVFDG
WMYPLDSTQQEQAKQPTLFLNVGDWQWNENLDVMKKIISHNDGNLALTLN
GAVHQCFSDFPFIFPSWLAKKFGVQGRTEPSLCMQAAIELSLAFLENGKD
GAQKLKDEKFSSFISNEIYGREKYKL


References
    Title: Type II platelet-activating factor-acetylhydrolase is essential for epithelial morphogenesis in Caenorhabditis elegans
    Inoue T, Sugimoto A, Suzuki Y, Yamamoto M, Tsujimoto M, Inoue K, Aoki J, Arai H
    Ref: Proc Natl Acad Sci U S A, 101:13233, 2004 : PubMed

            

    Title: Genome sequence of the nematode C. elegans: a platform for investigating biology. The C. elegans Sequencing Consortium
    CEGSC
    Ref: Science, 282:2012, 1998 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer