Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canfa-pafa

Canis lupus familiaris (Dog) (Canis familiaris), plasma PAF acetylhydrolase

Relationship
Family|PAF-Acetylhydrolase
Block| X
Position in NCBI Life Tree|Canis lupus familiaris
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Carnivora: N E > Caniformia: N E > Canidae: N E > Canis: N E > Canis lupus: N E > Canis lupus familiaris: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : U34246
1 UniProt : Q28262
1 Ncbi-nid : 1054900
1 Ncbi-pid : 1054901
1 UniProt : Q28262
1 Interpro : Q28262
1 Prodom : Q28262
1 Pfam : Q28262
1 PIRSF : Q28262
1 SUPERFAM : Q28262
Sequence
Graphical view for this peptide sequence: canfa-pafa
Colored MSA for PAF-Acetylhydrolase (raw)
MLPPKLHALFCLCSCLTLVHPIDWQDLNPVAHIRSSAWANKIQALMAAAS
IRQSRIPKGNGSYSVGCTDLMFDYTNKGTFLRLYYPSQEDDHSDTLWIPN
KEYFFGLSKYLGTPWLMGKILSFFFGSVTTPANWNSPLRTGEKYPLIVFS
HGLGAFRTIYSAIGIDLASHGFIVAAIEHRDGSASATYYFKDQSAAEIGN
KSWSYLQELKPGDEEIHVRNEQVQKRAKECSQALNLILDIDHGRPIKNVL
DLEFDVEQLKDSIDRDKIAVIGHSFGGATVLQALSEDQRFRCGIALDAWM
LPLDDAIYSRIPQPLFFINSERFQFPENIKKMKKCYSPDKERKMITIRGS
VHQNFADFTFTTGKIVGYIFTLKGDIDSNVAIDLCNKASLAFLQKHLGLR
KDFDQWDSLIEGKDENLMPGTNINITNEHDTLQNSPEAEKSNLD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLPPKLHALFCLCSCLTLVHPIDWQDLNPVAHIRSSAWANKIQALMAAAS
IRQSRIPKGNGSYSVGCTDLMFDYTNKGTFLRLYYPSQEDDHSDTLWIPN
KEYFFGLSKYLGTPWLMGKILSFFFGSVTTPANWNSPLRTGEKYPLIVFS
HGLGAFRTIYSAIGIDLASHGFIVAAIEHRDGSASATYYFKDQSAAEIGN
KSWSYLQELKPGDEEIHVRNEQVQKRAKECSQALNLILDIDHGRPIKNVL
DLEFDVEQLKDSIDRDKIAVIGHSFGGATVLQALSEDQRFRCGIALDAWM
LPLDDAIYSRIPQPLFFINSERFQFPENIKKMKKCYSPDKERKMITIRGS
VHQNFADFTFTTGKIVGYIFTLKGDIDSNVAIDLCNKASLAFLQKHLGLR
KDFDQWDSLIEGKDENLMPGTNINITNEHDTLQNSPEAEKSNLD


References
    Title: Genome sequence, comparative analysis and haplotype structure of the domestic dog
    Lindblad-Toh K, Wade CM, Mikkelsen TS, Karlsson EK, Jaffe DB, Kamal M, Clamp M, Chang JL, Kulbokas EJ, 3rd and Lander ES <224 more author(s)>
    Ref: Nature, 438:803, 2005 : PubMed

            

    Title: Anti-inflammatory properties of a platelet-activating factor acetylhydrolase
    Tjoelker LW, Wilder C, Eberhardt C, Stafforini DM
    Ref: Nature, 374:549, 1995 : PubMed

            

    Title: Plasma platelet-activating factor acetylhydrolase is a secreted phospholipase A2 with a catalytic triad
    Tjoelker LW, Eberhardt C, Unger J, Le Trong H, Zimmerman GA
    Ref: Journal of Biological Chemistry, 270:25481, 1995 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer