Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: chlgu-a0a3l8s7u5

Chloebia gouldiae (Gouldian finch) (Erythrura gouldiae). DLH domain-containing protein

Relationship
Family|CMBL
Block| X
Position in NCBI Life Tree|Chloebia gouldiae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Sauropsida: N E > Sauria: N E > Archelosauria: N E > Archosauria: N E > Dinosauria: N E > Saurischia: N E > Theropoda: N E > Coelurosauria: N E > Aves: N E > Neognathae: N E > Passeriformes: N E > Passeroidea: N E > Estrildidae: N E > Erythrura: N E > Erythrura gouldiae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : QUSF01000042
1 UniProt : A0A3L8S7U5
1 UniProt : A0A3L8S7U5
1 Interpro : A0A3L8S7U5
1 Pfam : A0A3L8S7U5
1 PIRSF : A0A3L8S7U5
1 SUPERFAM : A0A3L8S7U5
Sequence
Graphical view for this peptide sequence: chlgu-a0a3l8s7u5
Colored MSA for CMBL (raw)
MADPFLYNTGERSHYGCLGHEVQVEYLKAYVCRPSFSTDKAVIVVHDVFG
WQFPDIRYIVDLVAGHGYITICPDFFKGTEPWTSTDHWADFPDWMKNHDP
MKVDKEADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLTAGVC
LYGIVRDSEERYSLLNPTFFIFGEKDHTISLDQIFLLEDKLKQYCKVPYK
IKVYPGQVHGFAQLKPEDMKPDDKPYIEEARRDMIDWIKMFV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADPFLYNTGERSHYGCLGHEVQVEYLKAYVCRPSFSTDKAVIVVHDVFG
WQFPDIRYIVDLVAGHGYITICPDFFKGTEPWTSTDHWADFPDWMKNHDP
MKVDKEADVVLKYLKEQCGAKKIGIVGFSWGGMAVHHLMLKNPQLTAGVC
LYGIVRDSEERYSLLNPTFFIFGEKDHTISLDQIFLLEDKLKQYCKVPYK
IKVYPGQVHGFAQLKPEDMKPDDKPYIEEARRDMIDWIKMFV


Reference
    Title: A non-coding region near Follistatin controls head colour polymorphism in the Gouldian finch
    Toomey MB, Marques CI, Andrade P, Araujo PM, Sabatino S, Gazda MA, Afonso S, Lopes RJ, Corbo JC, Carneiro M
    Ref: Proc Biol Sci, 285:, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer