Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cimle-d1fqg8

Cimex lectularius (Bed bug) (Acanthia lectularia) Salivary secreted esterase 1 and 2 ClSChE

Comment
D1FQG8 G1K818 may be different alleles of same gene


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Cimex lectularius
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Prosorrhyncha: N E > Heteroptera: N E > Euheteroptera: N E > Neoheteroptera: N E > Panheteroptera: N E > Cimicomorpha: N E > Cimicoidea: N E > Cimicidae: N E > Cimex: N E > Cimex lectularius: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: EZ420068, EZ420069, GU597837
>3 UniProt links 1 more: D1FQG8, G1K818, D1FQG9
>3 UniProt links 1 more: D1FQG8, G1K818, D1FQG9
>3 Interpro links 1 more: D1FQG8, G1K818, D1FQG9
>3 Prodom links 1 more: D1FQG8, G1K818, D1FQG9
>3 Pfam links 1 more: D1FQG8, G1K818, D1FQG9
>3 PIRSF links 1 more: D1FQG8, G1K818, D1FQG9
>3 SUPERFAM links 1 more: D1FQG8, G1K818, D1FQG9
Sequence
Graphical view for this peptide sequence: cimle-d1fqg8
Colored MSA for ACHE (raw)
MWWLLVSTLLISVGSSSSEDNLVVDTDKGKVQGVTLKSATGKDVDAWLGI
PFAKPPTGNLRFKLPQPPEKWDDTKQATRQPNSCVQTIDTTFGDFPGSNM
WNANTDLSEDCLYLNVIVPKPRPTSNNKAPVMLYIFGGGFYCGSATLDVY
DPKTLASEENVIVVSIQHRVASLGFLYLGTGEAPGNMGLFDQRMAMKWVK
DNIQNFGGDPNKITLFGMSSGASSIGLHLMAPESHSLFNNAILESGTAFT
PWTLMSKEENKKRGLDLAKQMKCTKDDNTHDISCLRSANATQMVYKEWEM
ETKPSGVYEFPFVPVVDSQQPFFKTGESSGDNKFKKTGVIVGSNKEEGIY
LLLYFLKDVLKKEEQTTVNEDQYKDAVEKIYPYLTEDNRRQIKDKYKTWQ
GADKSNDYKDALDKMVGDSNITCSVNQFADVYAGLQQDVYVYLFDRISNV
SPWPKWTGGMHGEETYYVFGEPLNATKGYSEADKKLSKEMMKYWANFART
GDPNKDDKGQTTSVTWPKYDTTQKKYLKLAEKLEEGSKYREDQCTFWKTL
GQHVSTNELDTSTSK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MWWLLVSTLLISVGSSSSEDNLVVDTDKGKVQGVTLKSATGKDVDAWLGI
PFAKPPTGNLRFKLPQPPEKWDDTKQATRQPNSCVQTIDTTFGDFPGSNM
WNANTDLSEDCLYLNVIVPKPRPTSNNKAPVMLYIFGGGFYCGSATLDVY
DPKTLASEENVIVVSIQHRVASLGFLYLGTGEAPGNMGLFDQRMAMKWVK
DNIQNFGGDPNKITLFGMSSGASSIGLHLMAPESHSLFNNAILESGTAFT
PWTLMSKEENKKRGLDLAKQMKCTKDDNTHDISCLRSANATQMVYKEWEM
ETKPSGVYEFPFVPVVDSQQPFFKTGESSGDNKFKKTGVIVGSNKEEGIY
LLLYFLKDVLKKEEQTTVNEDQYKDAVEKIYPYLTEDNRRQIKDKYKTWQ
GADKSNDYKDALDKMVGDSNITCSVNQFADVYAGLQQDVYVYLFDRISNV
SPWPKWTGGMHGEETYYVFGEPLNATKGYSEADKKLSKEMMKYWANFART
GDPNKDDKGQTTSVTWPKYDTTQKKYLKLAEKLEEGSKYREDQCTFWKTL
GQHVSTNELDTSTSK


References
    Title: Molecular and biochemical characterization of the bed bug salivary gland cholinesterase as an acetylcholine-sequestering enzyme
    Kim JH, Hwang CE, Yoon KA, Seong KM, Lee J, Lee SH
    Ref: Insect Biochemistry & Molecular Biology, 102:52, 2018 : PubMed

            

    Title: Identification and characterization of three cholinesterases from the common bed bug, Cimex lectularius
    Seong KM, Kim YH, Kwon DH, Lee SH
    Ref: Insect Molecular Biology, 21:149, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer