Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: citsi-Q9MV14

Citrus sinensis (Sweet orange) Citrus limon (Lemon) (Citrus limonum), Citrus clementina chlorophyllase

Comment
Other strains: Citrus sinensis (Sweet orange) Citrus limon (Lemon) (Citrus limonum) Citrus clementina chlorophyllase Probably a new family and a new function Chlorophyllase (EC 3.1.1.14) sequence of Citrus unshiu (Satsuma orange)Azuma R.K., Kurata H., Shimokawa K., Adachi M. is quasi identical Trembl Q94LX1


Relationship
Family|Chlorophyllase_Plant
Block| L
Position in NCBI Life Tree|Citrus sinensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Sapindales: N E > Rutaceae: N E > Aurantioideae: N E > Citrus: N E > Citrus sinensis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AF160869, AB056126, FJ174793
>3 UniProt links 3 more: Q9MV14, Q94LX1, B6DX58
>3 UniProt links 3 more: Q9MV14, Q94LX1, B6DX58
>3 Interpro links 3 more: Q9MV14, Q94LX1, B6DX58
>3 Pfam links 3 more: Q9MV14, Q94LX1, B6DX58
>3 PIRSF links 3 more: Q9MV14, Q94LX1, B6DX58
>3 SUPERFAM links 3 more: Q9MV14, Q94LX1, B6DX58
Sequence
Graphical view for this peptide sequence: citsi-Q9MV14
Colored MSA for Chlorophyllase_Plant (raw)
MAAMVDAKPAASVQGTPLLATATLPVFTRGIYSTKRITLETSSPSSPPPP
KPLIIVTPAGKGTFNVILFLHGTSLSNKSYSKIFDHIASHGFIVVAPQLY
TSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAVMGHSRGG
QTAFALSLRYGFGAVIGLDPVAGTSKTTGLDPSILSFDSFDFSIPVTVIG
TGLGGVARCITACAPEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNP
SDVKSWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFYGDAEDFRQIL
KDPSFAPIKLDSVEYIDASSMLTTTHVKV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAAMVDAKPAASVQGTPLLATATLPVFTRGIYSTKRITLETSSPSSPPPP
KPLIIVTPAGKGTFNVILFLHGTSLSNKSYSKIFDHIASHGFIVVAPQLY
TSIPPPSATNELNSAAEVAEWLPQGLQQNLPENTEANVSLVAVMGHSRGG
QTAFALSLRYGFGAVIGLDPVAGTSKTTGLDPSILSFDSFDFSIPVTVIG
TGLGGVARCITACAPEGANHEEFFNRCKNSSRAHFVATDYGHMDILDDNP
SDVKSWALSKYFCKNGNESRDPMRRCVSGIVVAFLKDFFYGDAEDFRQIL
KDPSFAPIKLDSVEYIDASSMLTTTHVKV


References
1 more
    Title: Chlorophyll breakdown by chlorophyllase: isolation and functional expression of the chlase1 gene from ethylene-treated citrus fruit and its regulation during development.
    Jacob-Wilk D, Holland D, Goldschmidt EE, Riov J, Eyal Y
    Ref: Plant J, 20:653, 1999 : PubMed

            

    Title: Distribution of chlorophyllase among components of chloroplast membranes in Citrus sinensis organs.
    Brandis A, Vainstein A, Goldschmidt EE
    Ref: Plant Physiol Biochem, 34:49, 1996 : PubMed

            

    Title: Ethylene induces de novo synthesis of chlorophyllase, a chlorophyll degrading enzyme, in Citrus fruit peel
    Trebitsh T, Goldschmidt EE, Riov J
    Ref: Proc Natl Acad Sci U S A, 90:9441, 1993 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer