Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: closh-l7vmb2

Clostridium stercorarium subsp. stercorarium, Para-nitrobenzyl esterase PnbA

Comment
Other strains: Clostridium stercorarium subsp. stercorarium (strain ATCC 35414 / DS) Ruminiclostridium [Clostridium] stercorarium subsp.[Clostridium] stercorarium subsp. leptospartum DSM 9219


Relationship
Family|Carb_B_Bacteria
Block| C
Position in NCBI Life Tree|Clostridium stercorarium subsp. stercorarium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Clostridiales: N E > Ruminococcaceae: N E > Ruminiclostridium: N E > [Clostridium] stercorarium: N E > [Clostridium] stercorarium subsp. stercorarium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: closh-l7vmb2
Colored MSA for Carb_B_Bacteria (raw)
MLRMVRVENGLVRGLPAADPRITSFKGIPFAAPPVGENRWKAPQPAKDWE
GVLEAFEFAPISMQAKTALDPNNIYTREWHVDPDIPMSEDCLYLNVWTPA
RNGDERLPVFVWFFGGGFQVGYTSEMEFDGERIARRGIVVVTVNYRLNSF
GFLCHPEITAESPDAPGNFGLLDQQAALRWVKRNIAAFGGDPDNITIGGQ
SAGGGSVLFHLTSPQNKGLFQRAIIQSGVFTPLYAGNPVPRMNMTLKEAE
REGIKFFEFLGVSSLKEARKLDAEYILKKTLEYNHFWWPVIDGVFCTGDA
FRLFVENRRLQVPLIMGHTSDEFLAAPDVKSKEEFRRMADEMFGNDAGEF
LELCGFNSGSIEEIKKNATVNSIEYAIRVAAKASLDAGSKSPIYYYVFDA
DIPGWDNPGAFHSVDLWFTFETLAKCWRPFVGKHYDLARQMCNYWANFIR
TGNPNGKDSTGEEMPEWEPYAVDAPYGMRFGDRVEFVRQQPGELMKFLVR
QYFKRNLS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLRMVRVENGLVRGLPAADPRITSFKGIPFAAPPVGENRWKAPQPAKDWE
GVLEAFEFAPISMQAKTALDPNNIYTREWHVDPDIPMSEDCLYLNVWTPA
RNGDERLPVFVWFFGGGFQVGYTSEMEFDGERIARRGIVVVTVNYRLNSF
GFLCHPEITAESPDAPGNFGLLDQQAALRWVKRNIAAFGGDPDNITIGGQ
SAGGGSVLFHLTSPQNKGLFQRAIIQSGVFTPLYAGNPVPRMNMTLKEAE
REGIKFFEFLGVSSLKEARKLDAEYILKKTLEYNHFWWPVIDGVFCTGDA
FRLFVENRRLQVPLIMGHTSDEFLAAPDVKSKEEFRRMADEMFGNDAGEF
LELCGFNSGSIEEIKKNATVNSIEYAIRVAAKASLDAGSKSPIYYYVFDA
DIPGWDNPGAFHSVDLWFTFETLAKCWRPFVGKHYDLARQMCNYWANFIR
TGNPNGKDSTGEEMPEWEPYAVDAPYGMRFGDRVEFVRQQPGELMKFLVR
QYFKRNLS


Reference
    Title: Complete Genome Sequence of Clostridium stercorarium subsp. stercorarium Strain DSM 8532, a Thermophilic Degrader of Plant Cell Wall Fibers
    Poehlein A, Zverlov VV, Daniel R, Schwarz WH, Liebl W
    Ref: Genome Announc, 1:e0007313, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer