Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: colgc-t0lm90

Colletotrichum gloeosporioides(Anthracnose fungus) (Glomerella cingulata) Carboxylesterase

Comment
Other strains: Colletotrichum gloeosporioides (strains Cg-14; Nara gc5) (Anthracnose fungus) (Glomerella cingulata) Carboxylesterase family protein


Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Colletotrichum gloeosporioides
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Glomerellales: N E > Glomerellaceae: N E > Colletotrichum: N E > Colletotrichum gloeosporioides: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AMYD01001507, KB020675
2 UniProt : T0LM90, L2G2Z6
2 UniProt : T0LM90, L2G2Z6
2 Interpro : T0LM90, L2G2Z6
2 Pfam : T0LM90, L2G2Z6
2 PIRSF : T0LM90, L2G2Z6
2 SUPERFAM : T0LM90, L2G2Z6
Sequence
Graphical view for this peptide sequence: colgc-t0lm90
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MTRLSLLAAFSTACATASALVPRQAVPGNDTGAAAPTAQVKNGSYYGIYS
QSYDQDFFLGIPYAQPPVDNLRYRAPQPLNSTWEGTRNATEYSPQCFGYG
SDTWVLGNYVSEDCLTINVVRPHGVSPDAKLPVAVWIHGGGLTNGGSSDP
RYNVSFIVEQSVRMGTPFIAASINYRLHAWGFLWSDEIKAAGAGNLGFRD
QRLALSWVQENIAAFGGDPEQVTLWAESAGARSVGTQMLAYGGRDDGLYR
AAIMQSGTGLETDFGEVESTTNTWQDYYDTLVNKTNCTSAADTLDCLRGL
PAWDLSDVINGTSSPSFNGMADGDFLPAPRSELINAGKFVNVPILIGANF
DEGTQFGQKGINTTEQWNSYLRAQGANNVTIEVFSALYPDIPRVGLPATL
DGRPAGDEADLGYMYKRAVAFGGDRAQHGPRRYWARKWAEANQTVYSYHF
NVLVNGMMPSDGAKHFQEVVFVFDNTDAVGYKTAVAVDPFAGKPETFKTL
ADMMSRMWVSFITKGDPNYNGVTNTTWPKYDVENPYNMAFDVNATGIAYQ
EPDTYRTEQIEYLIQKLWT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTRLSLLAAFSTACATASALVPRQAVPGNDTGAAAPTAQVKNGSYYGIYS
QSYDQDFFLGIPYAQPPVDNLRYRAPQPLNSTWEGTRNATEYSPQCFGYG
SDTWVLGNYVSEDCLTINVVRPHGVSPDAKLPVAVWIHGGGLTNGGSSDP
RYNVSFIVEQSVRMGTPFIAASINYRLHAWGFLWSDEIKAAGAGNLGFRD
QRLALSWVQENIAAFGGDPEQVTLWAESAGARSVGTQMLAYGGRDDGLYR
AAIMQSGTGLETDFGEVESTTNTWQDYYDTLVNKTNCTSAADTLDCLRGL
PAWDLSDVINGTSSPSFNGMADGDFLPAPRSELINAGKFVNVPILIGANF
DEGTQFGQKGINTTEQWNSYLRAQGANNVTIEVFSALYPDIPRVGLPATL
DGRPAGDEADLGYMYKRAVAFGGDRAQHGPRRYWARKWAEANQTVYSYHF
NVLVNGMMPSDGAKHFQEVVFVFDNTDAVGYKTAVAVDPFAGKPETFKTL
ADMMSRMWVSFITKGDPNYNGVTNTTWPKYDVENPYNMAFDVNATGIAYQ
EPDTYRTEQIEYLIQKLWT


References
    Title: Global aspects of pacC regulation of pathogenicity genes in Colletotrichum gloeosporioides as revealed by transcriptome analysis
    Alkan N, Meng X, Friedlander G, Reuveni E, Sukno S, Sherman A, Thon M, Fluhr R, Prusky D
    Ref: Mol Plant Microbe Interact, 26:1345, 2013 : PubMed

            

    Title: Comparative genomic and transcriptomic analyses reveal the hemibiotrophic stage shift of Colletotrichum fungi
    Gan P, Ikeda K, Irieda H, Narusaka M, O'Connell RJ, Narusaka Y, Takano Y, Kubo Y, Shirasu K
    Ref: New Phytol, 197:1236, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer